Documents that we receive from a manufacturer of a Samsung Q45c can be divided into several groups. They are, among others:
- Samsung technical drawings
- Q45c manuals
- Samsung product data sheets
- information booklets
- or energy labels Samsung Q45c
All of them are important, but the most important information from the point of view of use of the device are in the user manual Samsung Q45c.
- UserManuals.org
- Samsung
- Samsung Laptop
- Samsung Q45c
Manual Samsung Q45c
Go to site of 199
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
- 109
- 110
- 111
- 112
- 113
- 114
- 115
- 116
- 117
- 118
- 119
- 120
- 121
- 122
- 123
- 124
- 125
- 126
- 127
- 128
- 129
- 130
- 131
- 132
- 133
- 134
- 135
- 136
- 137
- 138
- 139
- 140
- 141
- 142
- 143
- 144
- 145
- 146
- 147
- 148
- 149
- 150
- 151
- 152
- 153
- 154
- 155
- 156
- 157
- 158
- 159
- 160
- 161
- 162
- 163
- 164
- 165
- 166
- 167
- 168
- 169
- 170
- 171
- 172
- 173
- 174
- 175
- 176
- 177
- 178
- 179
- 180
- 181
- 182
- 183
- 184
- 185
- 186
- 187
- 188
- 189
- 190
- 191
- 192
- 193
- 194
- 195
- 196
- 197
- 198
- 199
Summary
-
Samsung Q45c - page 1
User Guide Q45c/Q46c/P200 ...
-
Samsung Q45c - page 2
Chapter 1. Getting Started Product Features 2 Before Y ou Start 3 Contents 6 Safety Precautions 7 USA ONL Y 18 Proper Posture During Computer Use 19 Important Safety Information 22 Replacement Parts and Accessories 24 Regulatory Compliance Statements 26 WEEE SYMBOL INFORMA TION 36 Overview 37 Front View 37 Status Indicators 38 Right View 39 Left Vi ...
-
Samsung Q45c - page 3
2 High Performance Notebook Computer ■ IntelCore™2DuoProcessor * .DDRIIMemory ■ WirelessLAN * ,Bluetooth * Easy-to-Use A V ■ Play A VStationand A VStationNow * areprovidedtoeasilyplayvarious multimediales. ■ CameraModuleInstalled * Sophisticated Design for In ...
-
Samsung Q45c - page 4
3 Before Y ou Start Before reading the User Guide, rst check the following information. User Guide Information This product is supplied with an Installation Guide , and a User Guide . Y ou can even more easily and conveniently use the computer by using any of the guides depending on your needs. Installation Guide This guide is provided so that y ...
-
Samsung Q45c - page 5
4 Safety Precaution Notations Icon Notation Description W arning Failingtofollowinstructionsmarkedwith thissymbol,maycausepersonalinjury andorfatality . Caution Failingtofollowinstructionsmarkedwith thissymbol,maycauseslightinjuryto yourselfordamageyourprop ...
-
Samsung Q45c - page 6
5 About the Product Capacity Representation Standard About HDD Capacity Representation Thecapacityofthestoragedevice(HDD,SSD)ofthemanufactureriscalculatedassumingthat1KB=1,000Bytes. However ,theoperatingsystem(Windows)calculatesthestoragedevicecapacityassumingthat1K ...
-
Samsung Q45c - page 7
6 Contents Chapter 1. Getting Started Product Features 2 Before Y ou Start 3 Contents 6 Safety Precautions 7 USA ONL Y 1 8 Proper Posture During Computer Use 1 9 Important Safety Information 2 2 Replacement Parts and Accessories 2 4 Regulatory Compliance Statements 2 6 WEEE SYMBOL INFORMA TION 3 6 Overview 3 7 Front View 37 Status Indicators 38 Rig ...
-
Samsung Q45c - page 8
7 Installation Related Do not install the product in places exposed to humidity such as a bathrooms. Thereisadangerofelectric shock. Use the product within the operatingconditionsspeciedinthe ManufacturersUserGuide. Keep the plastic bags out of the reach of children. There is a danger of suffocation. Keep a ...
-
Samsung Q45c - page 9
8 Power Related Do not touch the mains plug or power cord with wet hands. Thereisadangerofelectricshock. Do not exceed the standard capacity (voltage/current) of a multiplug or power outlet extension when using it for the product. Thereisadangerofelectricshock orrehazard. If the power cord or power ou ...
-
Samsung Q45c - page 10
9 Do not bend the power cord excessively or do not place a heavy object over the power cord. It is especially important to keep the power cord out of reach of infants and pets. Ifthecordisdamaged,itmay causeelectricshockorre. If water or another substance enters the power input jack, AC adapter or the computer , ...
-
Samsung Q45c - page 11
10 Usage Related Disconnect all cables connected to the computer before cleaning it. If you are using a notebook computer , remove the battery . Thereisadangerofelectricshock or damage to the product. Do not connect a phone line connected to a digital phone to the modem. Thereisadangerofaelectric shock,? ...
-
Samsung Q45c - page 12
1 1 Upgrade Related Never disassemble the power supply or AC adapter . Thereisadangerofelectricshock. When removing the RTC (Real Time Clock) battery , keep it out of the reach of children as they could touch and/or swallow it. There is a danger of choking. If a childhasswallowedit,contacta doctorimmediately . ...
-
Samsung Q45c - page 13
12 Custody and Movement Related Follow the instructions for the relevant location (e.g. airplane, hospital, etc.) when using a wireless communication device (wireless LAN, Bluetooth, etc.).. When carrying the notebook computer with other items, such as the adapter , mouse, books etc, take care not to press anything against the notebook computer . I ...
-
Samsung Q45c - page 14
13 Caution Failingtofollowinstructionsmarkedwiththissymbolmaycauseslightinjuryordamagetotheproduct. Installation Related Battery Usage Related Do not block the ports (holes), vents, etc. of the product and do not insert objects. Damagetoacomponentwithin thecomputermaycauseel ...
-
Samsung Q45c - page 15
14 Usage Related Do not place a candle, lighted cigar , etc. over or on the product. Thereisadangerofre. Use a wall outlet or multi-plug with a grounding part. Failingtodosomaycauseelectric shockhazard. Make sure to have the product tested by a safety service engineer after repairing the product. Authorised ...
-
Samsung Q45c - page 16
15 Do not use a damaged or modied CD/Floppy Disk. There is a danger of damaging the productorpersonalinjury . Do not insert your ngers into the PC Card Slot. Thereisadangerofinjuryor electricshock. Use recommended computer cleansing solution when cleaning the product and only use the computer when it is comple ...
-
Samsung Q45c - page 17
16 Never disassemble or repair the product by yourself. Thereisadangerofelectric shockorle. T o connect a device that is not manufactured or authorized by Samsung Electronics, enquire at your service center before connecting the device. There is a danger of damaging the product. Custody and Movement Related When moving th ...
-
Samsung Q45c - page 18
17 Cautions on Preventing Data Loss (Hard Disk Management) T ake care not to damage the data on a hard disk drive. ■ A harddiskdriveissosensitive toexternalimpactthatan externalimpactmaycauseloss of data on the surface of the disk. ■ T akeextracare,because moving the computer ...
-
Samsung Q45c - page 19
18 USA ONL Y ThisPerchloratewarningappliesonlytoprimaryCR(MaganeseDioxide)Lithiumcoincellsintheproductsoldor distributedONL YinCaliforniaUSA. “PerchlorateMaterial-specialhandlingmayapply ,Seewww .dtsc.ca.gov/hazardouswaste/perchlorate.” LAMP(S)INSIDETHI ...
-
Samsung Q45c - page 20
19 Proper Posture Adjust the heights of desks and chairs appropriate to your height. Theheightsaretobeadjustedsothatyourarmformsa rightanglewhenyouplaceyourhandoverthekeyboard whilesittingdownonachair . Adjusttheheightofchairsothatyourheelis? ...
-
Samsung Q45c - page 21
20 Eye Position Keep the monitor or LCD away from your eyes by at least 50cm. ■ AdjusttheheightofthemonitorandtheLCDscreenso thatitstopheightisequaltoorlowerthanyoureyes. ■ AvoidsettingthemonitorandLCDexcessivelybright. ■ Keepthemonitorand ...
-
Samsung Q45c - page 22
21 V olume Control (Headphones and Speakers) Check your volume rst to listen to music. ■ Checkifthevolumeistooloudbeforeusing headphones. ■ Itisnotrecommendedusingheadphonesforlong periods of time. ■ Anydeviationfromtheequalizerdefaultsettingcould cause hea ...
-
Samsung Q45c - page 23
22 Y oursystemisdesignedandtestedtomeetthelatest standardsforsafetyofinformationtechnologyequipment. However ,toensuresafeuseofthisproduct,itisimportant thatthesafetyinstructionsmarkedontheproductandin thedocumentationarefollow ...
-
Samsung Q45c - page 24
23 Care During Use ■ Donotwalkonthepowercordorallowanythingtorest on it. ■ Donotspillanythingonthesystem.Thebestwayto avoidspillsistonoteatordrinknearyoursystem. ■ SomeproductshaveareplaceableCMOSbatteryon the ...
-
Samsung Q45c - page 25
24 Caution Donotputrechargeablebatteriesorproducts poweredbynon-removablerechargeablebatteries inthegarbage. ContacttheSamsungHelplineforinformationonhowto disposeofbatteriesthatyoucannotuseorrechargeany longer . Followal llocalregulat ions? ...
-
Samsung Q45c - page 26
25 Thesocket-outletshallbeinstalledneartheequipment andshallbeeasilyaccessible. Do not unplug the power cord out by pulling the cable only . Connect and Disconnect the AC adapter Thepowercordset(wallplug,cableand ACadapterplug) youreceivedwithyourcomputermeetsthe ...
-
Samsung Q45c - page 27
26 Regulatory Compliance Statements Wirel ess Guidance Lowpower ,RadioLANtypedevices(radiofrequency(RF)wirelesscommunicationdevices),operatinginthe2.4GHz Band,maybepresent(embedded)in yournotebooksystem.Thef ollowingsectionisageneraloverviewofconsi ...
-
Samsung Q45c - page 28
27 Caution ■ Radiofrequencywirelesscommunicationcaninterferewithequipmentoncommercialaircraft.Currentaviationregulations requirewirelessdevicestobeturnedoffwhiletravelinginanairplane. 802.1 1B(alsoknownaswirelessEthernetorWi)andBluetooth ...
-
Samsung Q45c - page 29
28 USA and Canada Safety Requirements and Notices Donot touchormo veantenna whiletheu nitistra nsmitting or receiving. Donotholdanycomponentcontainingtheradiosuchthat theantennaisverycloseortouchinganyexposedparts ofthebody ,especiallytheface ...
-
Samsung Q45c - page 30
29 Caution Thisequipmenthasbeentestedandfoundto complywiththelimitsforaClassBdigitaldevice pursuanttoPart15oftheFCCRules.Theselimits aredesignedtoprovidereasonableprotection againstharmfulinterferenceinaresidential installation.? ...
-
Samsung Q45c - page 31
30 Caution Wirelessdevicesarenotuserserviceable.Donot modifytheminanyway . Modicationtoawirelessdevicewillvoidthe authorizationtouseit.Contactmanufacturerfor service. Caution FCC Statement for Wireless LAN use: “Whileinstallingandoperatingthistra ...
-
Samsung Q45c - page 32
31 Thisequipmentcannotbeusedonpubliccoinphone serviceprovidedbythetelephonecompany .Connection topartylineserviceissubjecttostatetariffs. TheT elephoneConsumerProtection Actof1991makes itunlawfulforanypersontouseacomputeroro ...
-
Samsung Q45c - page 33
32 Thistransmittermustnotbecollocatedoroperatein conjunctionwithanyotherantennaortransmitterexcept theinstalledBluetoothtransmitter . Operationofthisdeviceissubjecttothefollowingtwo conditions:(1)Thisdevicemaynotcauseharmful interferenc ...
-
Samsung Q45c - page 34
33 European Union CE Marking and Compliance Notices ProductsintendedforsalewithintheEuropeanUnionare markedwiththeConformitéEuropéene(CE)Marking, whichindicatescompliancewiththeapplicableDirectives andEuropeanstandardsandamendmentsidentied below .Thise ...
-
Samsung Q45c - page 35
34 T ranslated Statements of Compliance [English] ThisproductfollowstheprovisionsoftheEuropeanDirec- tive1999/5/EC. [Danish] Detteprodukterioverensstemmelsemeddeteuropæiske direktiv1999/5/EC [Dutch] DitproductisinnavolgingvandebepalingenvanEurop- eesDirectief199 ...
-
Samsung Q45c - page 36
35 General Europeanstandardsdictatemaximumradiatedtrans - mitpowerof100mWeffectiveisotropicradiatedpower (EIRP)andthefrequencyrange2400–2483.5MHz. Belgium Theproductmaybeusedoutdoors,butforoutdoortrans - missionsoveradistanceof300morm ...
-
Samsung Q45c - page 37
36 WEEE SYMBOL INFORMA TION Correct Disposal of This Product (W aste Electrical & Electronic Equipment) (Applicable in the European Union and other European countries with separate collection systems) Thismarkingshownonthep roductoritsliterature,indicatesthatit shouldnotbedisposedwithotherho ...
-
Samsung Q45c - page 38
37 Overview Before Y ou Start! ■ * Theitemsmarkedwiththissymbolareoptionalitemswhichmaybechangedormaynotbeprovideddependingonthe computermodel. ■ Theactualcolorandappearanceofthecomputermaydifferfromthepicturesusedinthisguide. ...
-
Samsung Q45c - page 39
38 4 Charge Status This shows the power source and the batterychargestatus. Green: Whenthebatteryisfully chargedorthebatteryisnotinstalled. Amber: Whenthebatteryisbeing charged. Off: Whenthecomputerisrunningon batterypowerwithoutbeingconnected to AC? ...
-
Samsung Q45c - page 40
39 Right V iew 1 Fan V ents The internal heat of the computer is emitted through these holes. Caution If the vents are blocked the computer may overheat. Avoid blocking the vents as this may be dangerous. 4 Modem Port * A port to which a telephone cable is connected to in order to dial up to the Internet. 3 Monitor Port A port used to connect a mon ...
-
Samsung Q45c - page 41
40 Left V iew 1 Wired LAN Port * ConnecttheEthernetcabletothisport. p. 95 2 CD Drive(ODD) * PlaysCDorDVDtitles. Since an ODD drive is optional, the installed drive dependsonthecomputermodel. p. 51 3 PCI ExpressCard Slot InstallthePCIExpresscardintothis s ...
-
Samsung Q45c - page 42
41 4 Security Lock Port Y ou can connect a Kensington lock to the Security Lock Port to prevent the computer from being stolen. Back V iew 2 Battery This is a Lithium-Ion rechargeable battery that supplies power to the computer . p. 144 1 DC Jack A jack to connect the AC adapter that supplies power to the computer . 3 USB Port Y ou can connect USB ...
-
Samsung Q45c - page 43
42 Bottom V iew 1 Battery Latches Thelatchusedtoremoveorinstallthebattery . p. 144 3 Memory Compartment Cover Themainmemoryisinstalledinsidethecover . p. 142 2 Hard Disk Drive Compartment Cover Theharddiskdriveisinstalledinsidethecover . ...
-
Samsung Q45c - page 44
43 T urning the Computer On and Off T urning the computer on 1 Installthe battery and connect the AC adapter . (Refertothe Installation Guide .). 2 LifttheLCDpanelup. 3 Pressthe Power button to turn the computer on. 4 Power button LEDislitwhilethecomputeristurned on. Note ■ If ...
-
Samsung Q45c - page 45
Chapter 2. Using the computer Keyboard 45 T ouchpad 48 CD Drive (ODD) 51 InsertingandEjectingaCD 5 1 BurningaCD 5 2 HDDVD(Optional) 5 3 Blu-Ray(Optional) 5 5 Multi Card Slot 57 PCI ExpressCard Slot 60 Connecting a Monitor 61 ConnectingaMonitor 6 1 Viewing ThroughaMonitor 6 1 UsingDua ...
-
Samsung Q45c - page 46
45 Keyboard Thekeyboardissuppliedaccordingtothecorrespondingcountry .Refertothekeyboardgureforthecorrespondingcountry . United Kingdom United States ...
-
Samsung Q45c - page 47
46 Shortcut Keys Y oucanusethefollowingfunctionsbypressingthekeysbelowwiththe Fn key . Fn+ Name Function REST (Sleep Mode) SwitchestoSleepmode. T owakethecomputerup,pressthePowerbutton. Gauge Showstheremainingbatterycharge. Y oucanonlyusethisfun ...
-
Samsung Q45c - page 48
47 Screen Brightness Control T oadjusttheLCDbrightnesspressthe Fn +( )key combinationorthe Fn +( )keycombination.The changedscreenbrightnessisdisplayedatthecenterof the screen for a moment. V olume Control T ocontrolthevolume,pressthe Fn + ...
-
Samsung Q45c - page 49
48 T ouchpad Thetouchpadprovidesthesamefunctionasamouseandtheleftandrightbuttonsofthetouchpadplaystheroleof theleftandrightbuttonsofamouse. Before Y ou Start! ■ UsetheT ouchpadwithyourngers.Usingasharpobjectmaydamagethe ...
-
Samsung Q45c - page 50
49 Moving the cursor on the screen Placeyourngeronthetouchpadslightlyandmoveyour nger .Themousecursorwillmoveaccordingly .Move yourngerinthedirectionyouwishtomovethecursor . Click Function Placeyourngeronthetouchpadandtapyour? ...
-
Samsung Q45c - page 51
50 Drag Function Draggingreferstomovinganitemtoanotherplaceafter selectingit. Pressandholddownthelefttouchpadbuttonoveran itemyouwanttodragandmovetheitemtothenew location. T ouchpad Scroll Function Thetouchpadscrollareaprovidesthemou ...
-
Samsung Q45c - page 52
51 CD Drive (ODD) Anopticaldiskdriveisoptionalandmaydifferdependingonyourcomputermodel.Fordetailedspecications,refer tothecatalogue. Before Y ou Start! Oneofthefollowingopticaldiskdrivesisinstalledonthiscomputer . DriveT ype Function RW -Combo Y ou ...
-
Samsung Q45c - page 53
52 IfyourcomputerhasawritableCDdrive,youcanwrite dataontoaCDorDVDorburnanaudioCD. CyberLink DVD Suite issuppliedwiththe System Software Media (oranadditionalCD)sothatyoucan burnaCDusingtheprogram. Installtheprovidedsoftwa ...
-
Samsung Q45c - page 54
53 HD-DVDisanextgenerationstoragemediathatcansavemoredatathantheexistingDVDformat. Y oucanrecordandplaybetterqualityHDmoviesthantheexistingSD-gradeDVDformat. T ype HD DVD DVD CD Logo Storage Capacity 15GB/30GB 4.7GB/8.5GB 0.65 GB Dat ...
-
Samsung Q45c - page 55
54 About HD DVD TheCyberLinkHDDVDSolutionprogramisprovided sothatuserswithHD-DVDDrivescanconvenientlyand easilyrecord multimedialesandot herdataontoHDDVD disks. Foramoredetaileddescriptionofthefunctions,referto thehelpsectionof ...
-
Samsung Q45c - page 56
55 Blu-Rayisanextgenerationstoragemediathatcansaveapproximately5to10timesmoredatathantheexistingDVD format.Y oucanrecordandplaybetterqualityHDmoviesthantheexistingSD-gradeDVDformat. T ype Blu-Ray DVD CD Logo Storage Capacity 25GB/50? ...
-
Samsung Q45c - page 57
56 About Blu-Ray TheCyberLinkBDSolution(hereafterCBDS)program isprovidedsothatuserswithBlu-RayDrivescan convenientlyandeasilyrecordmultimedialesandother dataontoBlu-Raydisks. Foramoredetaileddescriptionofthefunctions,referto thehelp? ...
-
Samsung Q45c - page 58
57 Multi Card Slot Usingthemulticardslot,youcanreadandwritedatatoaMemoryStick,MemoryStickPro,SDcard,MMC,MMC Plus,andxDcard. Y oucanuseacardasaremovablediskandconvenientlyexchangedatawithdigitaldevicessuchasadigital ...
-
Samsung Q45c - page 59
58 T o Insert and Use a Memory Card 1 Insert a card into the slot according to the directions printed on the slot. 2 The card drive appears. Click Open folder and view les . If the window does not appear , click Start > Computer . Note If a window asking to scan and change appears, click Continue Without Scanning . This will proceed to Step 2 ...
-
Samsung Q45c - page 60
59 T o remove a memory card 1 Pushthetipofthecardlightly . 2 Ifthecardpopsupwithaclickingsound,removethe card. T o format a memory card Y ouhavetoformatacardrsttouseit. Caution Formattingacarddeletesalldatasavedonthe card.Ifthe? ...
-
Samsung Q45c - page 61
60 T o insert a card 1 Insertacardintotheslotonthesideofthe computer . 2 Ifyouinsertacardintotheslot,Windowsrecognizes thecardautomaticallyoramessagetelling youtoinstalladriverappears.Ifthecardisnot automaticallyrecogni ...
-
Samsung Q45c - page 62
61 Connecting a Monitor Usinganexternaldisplaydeviceisusefulwhenyouaregivingapresentationorwatchingavideoormoviethrough yourmonitor . Before Y ou Start! Y ouhavetobuyaconnectioncableadditionally . ConnectthemonitortotheMonitorport. Connecting a Mon ...
-
Samsung Q45c - page 63
62 Using Dual V iew DualViewenablesuserstoexpandtheircomputerscreen overtwodisplaydevices. DualViewisconvenientwhenawideoperatingspaceis needed.Inaddition,sinceDualViewoperatesasifthere are2graphiccardspresentevenwhenthereisonl ...
-
Samsung Q45c - page 64
63 () 3 WhennotebookLCDissetasthemaindevice,the 1digitisdisplayedoveritandthe2digitisdisplayed overtheauxiliarydisplaydevice.Nowyoucan expandtheDesktopscreenover2displaydevices. WhenusingDualView ,itisrecommendedse ...
-
Samsung Q45c - page 65
64 Adjusting the V olume using the Keyboard Pressthe Fn +( )keycombinationor Fn +( )key combinationtoadjustthevolume. Pressthe Fn +( )keycombinationtoturnthevolume on or off. Adjusting the V olume using the V olume Adjustment Program Clickthe V olume icon( ...
-
Samsung Q45c - page 66
65 Using the Sound Recorder TheprocedurestorecordsoundusingtheWindows Recorderaredescribedbelow . 1 Connectamicrophonetothemicrophonejack. 2 Right-clickoverthe V olume icon ( )onthetaskbar andselect Recording Device . 3 Checkifthemicrophoneisset ...
-
Samsung Q45c - page 67
66 Using Digital Output (S/PDIF) Y oucanenjoy5.1channelsurroundsoundbyusingtheHeadphone/S/PDIFjack. Before Y ou Start! T o listen to 5.1 channel surround sound, follow the procedures below. ■ Connecttoa5.1channelspeakersystemusingtheHeadphone/S/PDIFjack. ■ SelectDigital? ...
-
Samsung Q45c - page 68
67 Connecting 5.1 Channel Speakers 1 ConnecttheS/PDIFcabletotheS/PDIFjackandconnecttheotherendofthecabletothe5.1channelspeaker system. Note ■ Sincetheprocedurestoconnecta5.1channelspeakersystemmaydifferdependingonthesystemmodel,? ...
-
Samsung Q45c - page 69
68 Selecting Digital Output in the DVD Player Program. SincethesoundsettingissettoDigitalOutputbydefault,youdonotadditionallyneedtocongureitfordigitaloutput. Y oucanconrmyoursettingsasfollows. 1 IftheCyberLinkPowerDVDprogramisnotinstal ...
-
Samsung Q45c - page 70
Chapter 3. The screen shots used in this chapter may differ from actual screens depending on the Windows V ista version and model. Using Microsoft W indows V ista About Microsoft Windows V ista 70 WelcomeCenter 7 0 HelpandSupport 7 1 Windows V ista Screen Layout 72 Desktop 7 2 StartMenu 7 4 Sidebar/Gadget 7 6 Window ...
-
Samsung Q45c - page 71
70 IntheWelcomeCenter ,youcanviewbriefdescriptionsofWindowsVistafunctionsandrunthefunctionsdirectly . 1 Click Start > Welcome Center . 2 Ifyouclickonanitem,informationonthefunctionisdisplayedinthedescriptionwindow . Forexample,ifyou? ...
-
Samsung Q45c - page 72
71 Help and Support WindowsHelpandSupportprovidesinformationonWindowsbasicfunctionsandusages. Click Start > Help and Support . Y oucanndhelpforfrequentlyusedbasicfunctionsusingFindan Answerandyoucansearchforhelpbyenteringa keywordinthe? ...
-
Samsung Q45c - page 73
72 Windows V ista Screen Layout Desktop Ifyouturnthecomputeron,theDesktopscreenappears. Thedesktopistheworkingareaonthecomputer .Itconsistsofalargeworkspaceandataskbaratthebottomasshown inthegurebelow . Note Thescreenlayoutmaydiff ...
-
Samsung Q45c - page 74
73 1 Recycle Bin Y oucandropuselesslesandfoldershere. 2 Shortcut Icons Y oucanlaunchprogramsbyclickingtheshortcuticonsontheDesktop. 3 Start Menu Themenufromwhichyoucanlaunchprograms. 4 Start Button Pressthestartbutton.TheStartmenuappears. 5 T askbar C ...
-
Samsung Q45c - page 75
74 Start Menu Themenufromwhichyoucanlaunchprograms. Click Start ( ).TheStartmenuappears. Alternatively ,presstheWindowskey( )onthekeyboard. Fixed Programs The program or search result is displayed. All Programs Y ou can search for les, folders, etc. Username Search Computer Control Pane ...
-
Samsung Q45c - page 76
75 Search Enablesuserstosearchforlesandfolders. Computer Showsstoragedevicessuchasharddiskdrives,CD/DVDdrives,networkdrives,etc. Inaddition,youcanmanagelesandfoldershere. Control Panel EnablesuserstoconguretheappearanceandsettingsofW ...
-
Samsung Q45c - page 77
76 Sidebar / Gadget SidebarisaverticalbarthatappearsatthesideoftheDesktop. A miniprogramcalledGadgetrunsovertheSidebarwhichshowsinformationsuchasstocks,schedule,weather ,etc.and providesfrequentlyusedtools. Y oucandownloadvariousGadgets ...
-
Samsung Q45c - page 78
77 Adding a Gadget Y oucanndagadgetinthe Gadget Gallery andaddittotheSidebar . 1 Ifyouclickthe + atthetopoftheSidebar ,theGadgetGalleryopens. 2 Ifyoudouble-clickonagadget,thegadgetisaddedtotheSidebar . Note ■ Y oucan? ...
-
Samsung Q45c - page 79
78 Exiting the Sidebar Right-clickontheSidebaricon( )intheSystemT raywiththeclockonthetaskbarandselect Exit toexittheSidebar . Note Closing the Sidebar ■ EvenifyouclosetheSidebar ,theSidebarcontinuesrunningintheSystemT rayintheclock? ...
-
Samsung Q45c - page 80
79 Window A windowisthebasicframeforacomputeroperation. Asanexample,let’sseethelayoutofa Pictures Window . Click Start > Pictures. Note TheitemsandnamesmaydifferdependingonyourcomputermodelandtheWindowsV istaversion. Window Layout 1 Address ...
-
Samsung Q45c - page 81
80 1 Address Display Line Showsthelocationofthecurrentlyselectedfolderorle. 2 Move Button Y oucanmovetothepreviousornextpagebyclickingtheBackorNextbuttons. Opensthepreviouslyopenedpage. Opensthenextpage,whenyouhavereturnedtoapr ...
-
Samsung Q45c - page 82
Window V iew Functions Note Ifyouhavesetupthe Aerofunction,youcanuse the window view functions. Ifyouwanttousethe Aerofunction,click Start > Control Panel > Appearance and Personalization > Window Color and Appearance .SelectWindow Aerofromthecolor schemesa ...
-
Samsung Q45c - page 83
Control Panel T ools for conguring Windows are located in the Control Panel. Opening the Control Panel Click Start > Control Panel . System and Maintenance Using this function, you can congure Windows performance options. Security Using this function, you can check the current security status to protect the computer and congure the secu ...
-
Samsung Q45c - page 84
User Accounts and Family Safety Y oucanchangetheuseraccountsettings,passwordsandconguretheParental Controlsfunction. Appearance and Personalize Usingthisfunction,youcanconguretheDesktopstyle,themeorscreensaver settings. Clock, Language, and Region Usingthisfun ...
-
Samsung Q45c - page 85
User Accounts UsingWindowsVistaUser Accounts,morethanoneusercaneasilysharethesamePC. Theprocedurestoaddanddeleteauseraccountandtoswitchusersaredescribedbelow . Adding User Accounts 1 Click Start > Control Panel> User Accounts and Family Safety . 2 Click? ...
-
Samsung Q45c - page 86
Removing User Accounts Note ■ Ifthereisonlyone administrator account for the computer ,youcannotdeletethe administrator account . ■ Y oucanonlydeleteanotheraccountwhenyou areloggedinasanadministrator . 1 Click Start > Control Panel > User Accounts and Family Saf ...
-
Samsung Q45c - page 87
Changing the screen resolution and the color Theresolutionreferstothenumberofpixelsdisplayedonthescreen.Whenincreasingtheresolution,theitemsonthe Desktopbecomesmallerandmoreitemscanbedisplayedonthescreen.Thehigherthecolorquality ,themor ...
-
Samsung Q45c - page 88
Conguring the Start Menu Power Button ThePowerbuttonontheStartmenu( )performs various operations depending on the settings. 1 Click Start > Control Panel > Hardware and Sound > Power Options and then Change Battery Settings . 2 Clickon Change Plan Settings inthecurrently selected? ...
-
Samsung Q45c - page 89
4 Selectapowerplanandclickthe OK button. T ype Description Power Button Image after Setting Change Sleep SetsthecomputertoenterSleepmode. Thescreenandharddiskwillbeturnedofftoreducethepowerconsumptionof theoverallsystem. IfyoupressthePower? ...
-
Samsung Q45c - page 90
Phishing Filter Settings 1 LaunchInternetExplorer . 2 Select T ools fromthemenuandclick Phishing Filter > Phishing Filter Settings . Phishing Filter Phishingisamethodusedbyhackerstoillegallycollectpersonalinformationsuchascreditcardnumbers,passwords, otheracc ...
-
Samsung Q45c - page 91
90 3 TheInternetOptionswindowopens. LocatethePhishingFilteritemintheSettingseld.Select T urn on automatic website checking andclickthe OK buttontousethePhishingFilter . 4 T onotusethePhishingFilter ,select T urn off automatic website checking in? ...
-
Samsung Q45c - page 92
User control function Usingthisfunction,youcancontrolthecontentyourchildrencanaccess.Y oucandetermineforhowlongtheycanuse thecomputerandthecontenttheycanaccess.Whenyouhavenishedthesettings,clickOKtonish. Conguring Parental Cont ...
-
Samsung Q45c - page 93
Using Activity Report Y oucanviewandevaluateyourchildren’sinternetaccess throughthe ActivityReport. 1 Openthe User Controls window referring to the descriptions of Parental Controls . 2 Set Activity Reporting to On . 3 T oviewthe ActivityReport,clickon View Activity Report on ...
-
Samsung Q45c - page 94
UsingWindowsMobileCenter ,youcaneasilycongurecomputersettingssuchasthevolume,thewirelessnetwork connectionsettings,thedisplaysettings,etc.allatthesametime. Note SomefunctionsmaynotbesupporteddependingontheWindowsVistaversion. 1 C ...
-
Samsung Q45c - page 95
Chapter 4. Using the Network Wired Network 95 Wireless Network 98 Connecting to a Wireless LAN 99 Using the Easy Network Manager (Optional) 100 Network Settings 100 Using in Another Location 102 Diagnosing the Network Status 103 Connecting with a Modem (Optional) 104 Bluetooth (Optional) 105 Bluetooth Function 105 Using Bluetooth 106 ...
-
Samsung Q45c - page 96
95 1 ConnectaLANcabletothecomputer ’sLANport. 2 Click Start > Control Panel > Network and Internet > Network and Sharing Center . 3 Click Manage Network Connections fromtheleft panel. 4 Right-clickoverthe Local Area Connection and select Properties . Wired Network A ? ...
-
Samsung Q45c - page 97
96 5 Select Internet Protocol V ersion 4 (TCP/IPv4) from the Networking tabandclick Properties . Note ■ TheLANdevicedrivermaydifferdependingon yourLANdevicemodel. ■ T oaddanetworkcomponent,click Install in the screenshowninthegureabove.Y oucan ...
-
Samsung Q45c - page 98
97 Using both DHCP and a xed IP simultaneously Using the Alternate Conguration providingbyWindows Vista,youcansetbothautomaticandxedIP addresses andthenyoucanselecttouseeitherofthemtoconnect to the Internet. 1 Click Start > Control Panel > Network an ...
-
Samsung Q45c - page 99
98 Wireless Network A wireless network (Wireless LAN) environment is a network environment that enables communicating between multiplecomputersathomeorasmall-sizeofcethroughwirelessLANdevices. Before Y ou Start! ■ Thedescriptions beloware for computer ...
-
Samsung Q45c - page 100
99 Connecting to a Wireless LAN Ifthereisan AP ,youcanconnecttotheInternetviathe APusingtheWirelessLANconnectionmethodprovided byWindowsVista. 1 Right-clickoverthe Network Connections ( )icon onthetaskbarandclick Connect to the Network . 2 ...
-
Samsung Q45c - page 101
100 Using the Easy Network Manager (Optional) Easy Network Manager is a program that helps congure the network settings. Easy Network Manager provides the following features. Y ou can easily congure the network and printer settings. p. 100~101 Y ou can immediately use the network without having to dene new network settings again af ...
-
Samsung Q45c - page 102
101 5 Select Internet Direct Connection andclickthe Next button. 6 SelecttheLANdevice,setuptheIPaddressand clickthe Next button. 7 Click Add Printer and set up a printer according to thewizard.Whentheprinterhasbeenadded,click the Refresh button,sel ...
-
Samsung Q45c - page 103
102 Using in Another Location Byconguringthenetworksettings(IPaddress,printer setting,etc.)foreachlocation,youcanimmediately accessthenetworkinoneclick,withoutperformingthe networksettingproceduresregardlessofyourlocation. 1 Click Start > All P ...
-
Samsung Q45c - page 104
103 Diagnosing the Network Status Y oucandiagnosethenetworkstateandndsolutionsfor whyyoucannotconnecttothenetwork. 1 LaunchEasyNetworkManager . 2 Select Management > Diagnose Status from the menu. 3 TheNetworkConnectionswindowappears. Click Start to star ...
-
Samsung Q45c - page 105
104 1 Connect the phone cable to the Modem port. T ake care to not connect a digital phone line to the modem port. 2 Connect to the Internet according to the instructions of your Internet service provider (ISP). Note If the Internet connection is terminated abnormally , the connection is not released and the corresponding cost can be accrued. Conne ...
-
Samsung Q45c - page 106
105 File T ransmission Y oucanexchangelesbetweentwoBluetoothdevices. Y oucanexchangeleswithanotherBluetoothdevicesuchasanothercomputer ,cell phone,PDA,etc. Network Access Y oucanconnecttoanotherBluetooth-installedcomputerinthesamewayasan A ...
-
Samsung Q45c - page 107
106 Using Bluetooth Theprocedurestoexchangelesbetweencomputers supportingBluetoothandtouseotherBluetoothdevices aredescribedbelow . Using Bluetooth Devices (Connecting Headset supporting Bluetooth) Asanexample,theprocedurestoconnecttoaheadset supportingBluetooth? ...
-
Samsung Q45c - page 108
107 4 Whenthesearchiscomplete,allavailableBluetooth devicesarelisted.SelecttheHeadsetfromthelist andclickthe Next button. Note ■ A Bluetoothdeviceisrepresentedbythedevice typeandname(DedicatedBluetoothID). ■ T ousetheBluetoot ...
-
Samsung Q45c - page 109
108 Exchanging Files between Bluetooth Computers Theprocedurestoexchangelesbetweencomputers withBluetoothcapabilityaredescribedbelow . 1 Onthecomputerwhichissendingale(hereafter Computer A),right-clickthe Bluetooth icon ( )on thetaskbarandselectFi ...
-
Samsung Q45c - page 110
109 Usage Instructions Bluetoothdevicestobeconnectedmustbewithina 3m(10ft.)distance. Forabettercommunicationsenvironment,there shouldbenowallsorobstaclesbetweentheBluetooth devices. Y oucanconnecttoonlyoneBluetoothdevicea ...
-
Samsung Q45c - page 111
Chapter 5. Using Applications Introducing Programs 1 1 1 CyberLink PowerDVD (Optional) 1 14 Samsung Update Plus (Optional) 1 16 Play A VStation (Optional) 1 18 LaunchingandScreenLayouts 1 1 8 MovieStation 1 1 9 MusicStation 12 3 PhotoStation 12 7 A VStation Now (Optional) 131 Start 131 Exit 13 1 ScreenLayout 1 ...
-
Samsung Q45c - page 112
1 1 1 Introducing Programs UsingthesoftwaresuppliedwiththeSamsungcomputer ,youcaneasilyusefunctionsandtroubleshootproblems. T rytousethesoftwareafterlearningaboutthebasicuseofthesoftware.Fordetailedinformation,refertothehelp section of the co ...
-
Samsung Q45c - page 113
1 12 Multi Media Functions CyberLink PowerDVD ( ) (Optional) T ousethisprogram,youhavetoinstalltheprogram manuallyusingtheadditionallysuppliedSystem SoftwareMedia(orotherCD). p. 1 14 Play A VStation ( ) (Optional) Play A VStationisanintegratedmultimediaprogram? ...
-
Samsung Q45c - page 114
1 13 T roubleshooting Functions SAMSUNG Magic Doctor ( ) SAMSUNGMagicDoctoristroubleshootingsoftware providedbySamsungComputerforsystemdiagnosis, andrestoringthesystem. Thesystemdiagnosisfunctionenablesusersto diagnosesystemproblemswithoutassistancefrom other ...
-
Samsung Q45c - page 115
1 14 1 InsertaDVDtitleintotheDVDdrive. 2 Select PowerDVD andclickthe OK button. Afteramoment,theDVDtitlewillplay . 3 IftheDVDtitleisnotautomaticallyplayed,click Start > All Programs > CyberLink DVD Suite > Power DVD > CyberLink PowerDVD . ...
-
Samsung Q45c - page 116
1 15 Note ■ Detailed Usage Formoredetailedusage,click Start > All Programs > Cyberlink DVD Suite > Power DVD > PowerDVD Help . ■ DVD Region Code A DVDtitlehasaregioncodeaccordingtotheinternationalspecicationssothatitcanbeplayedonlyinthatspecic? ...
-
Samsung Q45c - page 117
1 16 Samsung Update Plus (Optional) SamsungUpdatePlusissoftwarethatexaminesandupdatestheSamsungsoftwareanddriversinstalledonyour Samsungcomputertothelatestversion. Before Y ou Start! ■ T osearchforupdatesandupdateyourcomputerusingSamsungUpdatePlu ...
-
Samsung Q45c - page 118
1 17 3 Ifthereareavailablesoftwareordriverupdatesfor yourcomputer ,theavailableupdateswillbelisted. Selecttherequiredupdatesfromthelistandclickon Install Updates to start the update. Caution Updates that must be installed separately . Ifyouselect Install f ...
-
Samsung Q45c - page 119
1 18 T olaunchtheprogram,click Start > All Programs > Samsung > Play A VStation > Play A VStation . Alternatively ,double-clickthePlay A VStationicon( )ontheDesktop. Movie Y oucanplayavideo(movie)le. Music Y oucanplayamusicleoranaudioCD. Photo Y ou ...
-
Samsung Q45c - page 120
1 19 Note ● What is EDI (Enhanced Digital Image)? EDI(EnhancedDigitalImage)isvisualqualityenhancementtechnologydevelopedbySamsungElectronics.Y oucanview clearerandsharperimagesbyenablingtheEDIfunctionwhenwatchingTVorplayingamovieonPlay A VStation ...
-
Samsung Q45c - page 121
120 Playing a Movie File TheprocedurestoplayamovieleregisteredtotheMOVIELibraryaredescribedbelow .Fortheprocedurestoregister lestotheLibrary ,referto p. 121. 1 Moveto Movie Station anddouble-click All Video intheleftmenupane. 2 ...
-
Samsung Q45c - page 122
121 Adding Videos to the Library TheMovieLibraryisalibrarywithmovielestobeused byMovieStation.Theprocedurestoaddmovieles savedonthecomputertotheLibraryaredescribedbelow . Y oucanaddlesorfolders. Asanexample,the procedures ...
-
Samsung Q45c - page 123
122 Highlight / Chapter Function UsingtheHighlightfunction,youcanwatchahighlighted part of a movie such as a sports or news item, etc. Using theChapterfunction,youcancreatechaptersforamovie andplaythemoviefromanyofthechapters. Note The Highlight/Chapter function? ...
-
Samsung Q45c - page 124
123 Music Station LaunchPlay A VStationandclick Music on the Station Bar . Playlist Window Music Search V olume Control Music Library Music T ype Repeat Setting Random Play Setting EQ EDS Play Control Buttons ...
-
Samsung Q45c - page 125
124 Playing an Audio CD TheprocedurestoplayanaudioCDaredescribedbelow . 1 InsertanaudioCDintotheCDdrive. 2 Ifthe AutoPlaywindowappears,select Play audio CD using Samsung PLA Y A VStation . 3 TheCDisplayed. Note IfaCDisalreadyinsertedintheC ...
-
Samsung Q45c - page 126
125 Playing a Music File IfamusicleisregisteredtotheMusicLibrary ,youcaneasilyplaythemusicle.Fortheprocedurestoregistertracksto theLibrary ,referto p. 126. 1 Moveto Music Station anddouble-clickon All Music . 2 Double-clickamusi ...
-
Samsung Q45c - page 127
126 Adding Music Files to the Library TheMusicLibraryisalibrarywithmusiclesusedby MusicStation.Theprocedurestoaddmusiclessaved onthecomputertotheLibraryaredescribedbelow . Y oucanaddles,folders. Asanexample,theprocedurestoad ...
-
Samsung Q45c - page 128
127 LaunchPlay A VStationandclickon Photo on the Station Bar . Photo Station Photo Library Photo List and Thumbnail Window Batch Edit Button SlideShow Button View and Edit Button ...
-
Samsung Q45c - page 129
128 Viewing an Image TheprocedurestoviewimagesregisteredtothePhoto LibraryindividuallyandviaaSlideShowaredescribed below . FortheprocedurestoregisterimagelestotheLibrary , refer to p. 130. 1 Moveto Photo Station anddouble-clickon All Images . 2 ...
-
Samsung Q45c - page 130
129 Editing an Image Y ou can change the shape of an image, edit an image orapplyspecialeffectstoanimage. Theimageediting functionsaredescribedbelow . 1 Moveto Photo Station anddouble-clickon All Images . 2 Clickonafolderwhichincludesimages,andthe imagesi ...
-
Samsung Q45c - page 131
130 Adding Images to the Library ThePhotoLibraryisalibrarywithimagelestobeusedbyPhotoStation.Theprocedurestoaddimagelessavedon thecomputertotheLibraryaredescribedbelow . Y oucanaddles,addfolders. Asanexample,theprocedures ...
-
Samsung Q45c - page 132
131 A VStation Now (Optional) A VStationNowisamultimediaprogramthatenablesyoutoeasilyenjoypictures,musicandvideos. Start Ifyoupressthe A V( )buttonwhenthecomputerison, A VStationNowwillbelaunched. Ifyoupressthe A V( )button when the comput ...
-
Samsung Q45c - page 133
132 Play Camera (Optional) PlayCameraisaprogramthatenablesuserstotakestillpicturesorrecordvideosusingthecamerainstalledonthe computer . Before Y ou Start! ■ Theprogramversionsdescribedinthismanualaresubjecttochangeandthescreenimagesand? ...
-
Samsung Q45c - page 134
Chapter 6. Settings and Upgrade LCD Brightness Control 134 BIOS Setup 135 EnteringtheBIOSSetup 13 5 TheBIOSSetupScreen 13 7 Setting a Boot Password 139 Changing the Boot Priority 141 Upgrading Memory 142 Battery 144 Installing/RemovingtheBattery 14 4 ChargingtheBattery 14 5 MeasuringtheRemainingBat ...
-
Samsung Q45c - page 135
134 Controlling the Brightness Using the Keyboard AdjusttheLCDbrightnessbypressingthe Fn +( )keyorthe Fn +( )key . TheLCDbrightnesscanchangeupto8levelsandthebrightnessincreasesby1levelwhenpressingthe Fn +( )key once. Note ■ M ...
-
Samsung Q45c - page 136
135 1 T urn the computer on. 2 Whenthebootingscreen(SAMSUNGlogo)appears,presstheF2keytoentertheBIOSSetup. Entering the BIOS Setup BIOS Setup TheBIOSSetupenablesyoutocongureyourcomputerhardwareaccordingtoyourneeds. Before Y ou Start! ■ UsetheBIOS ...
-
Samsung Q45c - page 137
136 3 Afteramoment,theBIOSsetupscreenappears. TheitemsintheBIOSsetupmaydifferdependingontheproduct. Setup Menu Setup Items Help Helpfortheselecteditem appearsautomatically . ...
-
Samsung Q45c - page 138
137 The BIOS Setup Screen Menu Description Main Usedtochangethebasicsystemandenvironmentsettings. Advanced Usedtocongureadvancedfunctionsonyourcomputerarounddevicesandchipsets. Security Usedtoconguresecurityfunctions,includingpasswords. Boot Usedtosettheboo ...
-
Samsung Q45c - page 139
138 System Setup Keys IntheSetup,youhavetousethekeyboard. F1 PresstoviewtheSetupHelp. Up & Down Keys Presstomoveupanddown. F5/F6 Presstochangetheitemvalue. F9 PresstoloadthedefaultSetupsettings. ESC Presstoreturntoahigherlevelmenuor ...
-
Samsung Q45c - page 140
139 Setting a Supervisor Password A SupervisorPasswordisrequiredtoturnthecomputer onortostarttheSystemSetup. WhensettingaSupervisorPassword,usersotherthana supervisor cannot use the computer . 1 Selectthe Security menuintheBIOSSetup. 2 In the Set Superv ...
-
Samsung Q45c - page 141
140 Setting a User Password Userscanstartthesystemwithauserpassword,but cannotentertheSystemSetup.Bydoingthis,youcan prevent other users from entering Setup. Beforeconguringauserpassword,asupervisor passwordmusthavebeencongured.Deactivatingthe? ...
-
Samsung Q45c - page 142
Boot Device Priority Boot priority order: ▼ IDE CD : xxxxxxxxxxxxxxxxxxx ▼ IDE HDD : SAMSUNG xxxxxxx ▼ USB KEY : Not Installed ▼ USB CDROM : Not Installed ▼ USB FDC : Not Installed ▼ USB HDD : Not Installed ▼ PCI BEV : Not Installed ▼ ▼ USB ZIP : Not Installed ▼ USB LS120 : Not Installed Excluded from boot order: Select system b ...
-
Samsung Q45c - page 143
142 Upgrading Memory One or more memory modules are installed on the computer . There are 2 memory slots. One is inside the main board and the other is at the bottom of the computer . Y ou can only add or replace memory to and from the memory slot at the bottom of the computer . Before Y ou Start! ■ Replace or install new memory only after shu ...
-
Samsung Q45c - page 144
143 3 Push the memory module down so that it is completely xed. If the memory does not t easily , push the memory module down while pulling the memory module latches outward. 4 Close the memory compartment cover and fasten the screw . Note Removing a memory module Pull the memory module latches outward. The memory module will pop up. Remove t ...
-
Samsung Q45c - page 145
144 1 Shutdownthesystem,closetheLCDpaneland placethecomputerupsidedownonaatsurface. 2 Pullthetwobatterylatchesoutwards( ),then removethebattery . 3 T oinstallthebatteryagain,slidethebatteryintothe system. Thebatterylat ...
-
Samsung Q45c - page 146
145 T o view on the battery Separatethebatteryandpressthe PUSH buttoninside thebattery .Theremainingbatterycharge(%)willbe displayed. Note Battery W arning ■ Y ouwillhearanalarmwhentheremaining batterychargereachesbelow10%. Inthiscase,connectt ...
-
Samsung Q45c - page 147
Extending the Battery Usage T ime 146 Decreasing the LCD Brightness Pressthe Fn +( )keysonthekeyboardtodecreasetheLCDbrightnesstoextendthebatteryusagetime. Using Easy Battery Manager (Optional) EasyBatteryManagerisapowermanagementprogramthatenablesusingtheb ...
-
Samsung Q45c - page 148
Samsung Optimized Thismodeisappropriatefornormalconditions.Itmaximizesthesystemperformancewhenthecomputerisrunningon ACpowerwhilemaximizingthebatteryusagetimewhenthecomputerisrunningonbatterypower . Multimedia Thismodeisappropriatefora? ...
-
Samsung Q45c - page 149
148 Using the Battery Calibration Function Whencharging/dischargingthebatteryrepeatedlyfora shorttimeonly ,thebatteryusagetimemaybereducedby thedifferencebetweentheactualbatterychargeandthe remainingchargedisplay . Inthiscase,theactualbatterycha ...
-
Samsung Q45c - page 150
149 Using the Security Lock Port Y oucanconnectaKensingtonlocktotheSecurityLockporttopreventyourcomputerbeingstolenwhenyouhaveto usethecomputerinapublicplace. T ousethisfeature,youhavetopurchasetheKensingtonlockadditionally .T ous ...
-
Samsung Q45c - page 151
Chapter 7. W indows Media Center About Package Contents and the Program Guide 151 Connecting and Setting Up Media Center 152 OptionalDevices 15 2 Using Media Center 156 StartScreenLayout 15 6 Pictures+Videos 15 7 Music 16 1 TV+Movies 16 5 Windows Media Center is provided for some versions of Windows V ista only . ...
-
Samsung Q45c - page 152
151 About the Package Contents ThepackagecontentsofyourSamsungcomputermaydifferdependingonthecomputermodel. TheMediaCenterremotecontrol,external-typeremotecontrolsensorandTVtunercardarenotsuppliedwithyour computerandthedevicesarenotrequire ...
-
Samsung Q45c - page 153
152 Connecting and Setting Up Media Center ThebasicusageofMediaCenterforMicrosoftWindowsVistaHomePremiumisdescribedbelow . Before Y ou Start! ■ ThismanualwilldescribeproceduresassumingthatyouareusingMediaCenterwithamouse. ■ SinceMediaCentersupp ...
-
Samsung Q45c - page 154
153 TV T uner Card UsingaTVtunercard,youcanwatchandrecord TV programs. Somemodelshavebuilt-inTVtunercards. Thismanual describestheirusageassumingyourcomputerhasa built-inTVtunercard. Caution TherearetwotypesofTVtunercards,built-in ...
-
Samsung Q45c - page 155
154 Media Center Setup ConnectallnecessarydevicesandsetupMediaCenter . Y ouhavetocompletethesettingstouseMediaCenter . 1 T urn the computer on. 2 Click Start > Windows Media Center or Start > All Programs > Windows Media Center . 3 Ifthefollowingstartscreenappears ...
-
Samsung Q45c - page 156
155 4 IfyouhaveselectedCustomSetup,continuewith thesetupaccordingtotheSetupWizardinstructions. IftherearenoinstalledTVtunercards,the TV relatedsetupstepswillappearduringtheMedia Centersetup. In addition, if the computer is not connected to the ...
-
Samsung Q45c - page 157
156 Start Screen Layout Before Y ou Start! Ifyouselected Run Setup Later intheMediaCenterstartscreenordidnotcompletetheSetupWizard,theSetupWizardscreen appearswhenlaunchingMediaCenter . Ifyoucompletethesetup,theMediaCenterstartscreenappears. ...
-
Samsung Q45c - page 158
157 Pictures + Videos: Y ou can view pictures, images and videoles. Music: Y oucanlistentomusicles,audioCDsandthe radio. TV + Movies : Y ou can watch and record TV programs andplayDVDtitles. Online Media: Y oucanaccessallkindsofmultimedia content over the . T asks: ...
-
Samsung Q45c - page 159
158 3 IftheLibrarySetupscreenappears,select Add Folder to W atch . 4 Specifythepathforthefolderaccordingtothe instructions on the screen. 5 Ifthefollowingscreenappears,click Finish . Y ou can viewthenewlyaddedfolderinthePictureLibraryor Video ...
-
Samsung Q45c - page 160
159 4 Ifyouselectapicture,thepictureisdisplayedinfull screen. Y oucanviewanotherpicturebyusingthePlay Controlbuttonsorthedirectionbuttonsonthe keyboard. 5 T oviewpicturesinaSlideShow ,clickon Play SlideShow . Alternatively ,select? ...
-
Samsung Q45c - page 161
160 Viewing Pictures and V ideos Saved on Removable Media The procedures to view pictures, images and videos savedonremovablemediainMediaCenteraredescribed below . 1 LaunchMediaCenter . 2 Insertaremovablemediawithpicture,imageor videoles. Removablemediareferstoa? ...
-
Samsung Q45c - page 162
161 InMusicofMediaCenter ,youcanplaymusiclesor audioCDs.Inaddition,youcanripthetracksofanaudio CDontothecomputerandplaythemlaterindividuallyor byusingaplaylist. Playing an Audio CD 1 LaunchMediaCenter . 2 PresstheEject? ...
-
Samsung Q45c - page 163
162 4 IftheRipCDwindowappears,click Y es . 5 RippingaCDbeginsbyshowingrotatingCDicon ontherightsidethatindicatesrippingaCDisin progress.Whenrippingiscomplete,therippingCD completemessageappears. Note Therippedtracksared ...
-
Samsung Q45c - page 164
163 Using Playlists Y oucaneasilycreate,manageandplayaplaylistwith rippedmusicalbumsandmusiclesdownloadedfromthe Internet. 1 LaunchMediaCenter ,andselect Music > Music Library . 2 Y oucansearchforamusiclebyselectingthe album,art ...
-
Samsung Q45c - page 165
164 6 Select Save As Playlist ,enteraplaylistnameand select Save .Ifyouhavearemotecontrol,youcan enteranameusingthenumericbuttonsonthe remotecontrol. 7 T oplaythesavedplaylist,select Media Center > Music Library > Playlist ,selecta ...
-
Samsung Q45c - page 166
165 Before Y ou Start! TheTVfunctionisonlyavailablewhena TVtunercardis installedonyourcomputer . TV + Movies Menus Live TV : Y oucanwatchliveTV programs. Recorded TV : Y ou can watch recorded TV programs. Guide (TV Broadcast Program Guide - EPG) Y ou can view the TV program guide. Y ou ...
-
Samsung Q45c - page 167
166 Playing a DVD TheprocedurestowatchaDVDtitlearedescribedbelow . 1 LaunchMediaCenter . 2 PresstheEjectbuttonoftheDVDdriveto open the trayandinsertaDVDtitle. Note IfyouinsertaDVDtitlewithoutstartingMedia Center ,the AutoPlay ...
-
Samsung Q45c - page 168
167 Online Media Y oucanaccessmoreonlinecontentthroughOnline Media. Online Mediaisaserviceprovidedbycontentproviders viatheMediaCenter .Y oucanenjoyallkindsof multimediacontentsuchasmovies,news,sports,etc. over the Internet. Note ■ T ous ...
-
Samsung Q45c - page 169
Chapter 8. Appendix Using McAfee SecurityCenter (Optional) 169 Using Samsung Magic Doctor (Optional) 170 Reinstalling Software 172 Q & A 174 DisplayRelated 17 4 ModemRelated 17 5 WiredNetwork(LAN)Related 17 7 WirelessNetwork(WLAN)Related 17 8 GameandProgramRelated 18 2 Bluetooth 18 3 HDDVD? ...
-
Samsung Q45c - page 170
169 Using McAfee SecurityCenter (Optional) A computervirusisaprogramthatdamagescomputerlesandinformationsavedonacomputer . A computer isinfectedbyanalreadyinfectedleorbyanothercomputerovertheInternet.Let’slearnhowtouseMcAfee Sec ...
-
Samsung Q45c - page 171
170 Using Samsung Magic Doctor (Optional) MagicDoctoristroubleshootingsoftwareprovidedbySamsungComputer . A usercandiagnosesystemproblemsvia one-clickorbyselectingdiagnosticitems. Before Y ou Start! Thescreensusedinthismanualmaydifferfromactualscreensacc ...
-
Samsung Q45c - page 172
171 Viewing My Computer Information Y oucanviewdetailedinformationaboutyourcomputerinSamsungMagicDoctor . Clickontheiconintheshapeofamonitoratthebottomofthemainprogramscreentoviewdetailedinformationabout the computer . ...
-
Samsung Q45c - page 173
172 Reinstalling Software Y oucanreinstallsoftwareusingtheSystemSoftwareMedia,whenadevicedriverorcomputerapplicationisnot workingproperly . Before Y ou Start! Whensoftwareisnotworkingproperly ,itisrecommendedremovingthesoftwareusingthe AddorRemo ...
-
Samsung Q45c - page 174
173 StandardInstallation Ifyouselectthisoption,programsnotcurrentlyinstalledonthecomputerarelisted. MinimumInstallation Ifyouselectthisoption,programsarelistedthatneedtobeinstalledonthecomputer(drivers, Windowsupdates,etc.). Y ou can ...
-
Samsung Q45c - page 175
174 Q & A Thissectionprovidesinformationonpossibleproblems,solutionsandotherreferencesforusingthesystem. Q The LCD screen is too dark or too bright. A T urntheLCDbacklightonoradjusttheLCD brightness. Press Fn +( )toturntheLCDbacklightonor press Fn ...
-
Samsung Q45c - page 176
175 Q The shortcut icons are not displayed on the screen even if I press the shortcut key . A TheshortcuticonsonlyappearwhentheEasy DisplayManagerprogramisinstalled. Q I have connected a monitor (or projector) to the computer , but the colors on the monitor are abnormally displayed. A Checkifthemonitor? ...
-
Samsung Q45c - page 177
176 Q When you are unable to make a call when using a switchboard A Ingeneral,thedialtoneofaswitchboardoradigital phoneswitchingsystemisnotcontinuousunlikethat ofaPSTNline.Therefore,themodemmaynotmake aphonecallasitmisreadsthedialtone? ...
-
Samsung Q45c - page 178
177 Q How can I receive a F AX in Sleep mode (Standby Mode)? A T oreceiveaF AXwhenthecomputerisinSleep Mode(StandbyMode),thecomputermustbe conguredasfollows. TheF AXprogrammustbeconguredsothatit receivesF AXESautomaticallyreferringtotheF AX? ...
-
Samsung Q45c - page 179
178 Q I cannot nd an AP . A V erifywhethertheWirelessLANLEDison. Ifitisturnedoff,turnitonbypressingtheWireless LANOn/Offbutton( Fn + ). Q The Wireless LAN device is operating properly , but I cannot connect to the Internet or to another computer . ► This is due to an in ...
-
Samsung Q45c - page 180
179 Q The signal strength is excellent, but I cannot connect to the network. ► Even if the signal strength is excellent, the network connection may not operate properly if the TCP/IP properties are not properly congured, or the network key (encryption key) is incorrect. A CheckthattheTCP/IP propertiesarecongured pro ...
-
Samsung Q45c - page 181
180 A2 V erifywhetherthesamenetworkkey(encryption key)hasbeenenteredforboththe APandthe computer .Thenetworkkeyisanencryptionkeyfor encryptingthedatatransmittedbetweenthe APand the computer . It is recommended setting the network keymanually . ? ...
-
Samsung Q45c - page 182
181 Q I cannot connect to a computer connected to the Ad-Hoc network. A1 Checkthesecuritysettingsandnetworknameofthe wireless Ad-Hocnetwork. A2 ChecktheTCP/IP settingsofthecomputers connectedtothewireless Ad-Hocnetwork.TheIP addressesofthecomputerstobeco ...
-
Samsung Q45c - page 183
182 Game and Program Related WindowsVistamaynotprovidesomefunctionsproperly whenperformingsomeapplicationsespeciallygames,or maycauseaproblemduetoadevicedrivercompatibility issue.Forthelatestdevicedriversandbugxes,please refertothere ...
-
Samsung Q45c - page 184
183 Bluetooth Q When no headset is found or cannot be connected A1 Iftheheadsetisalreadyconnectedtoanother device,youwillnotbeabletondtheheadsetand cannot connect to the headset even if the headset is found.Disconnecttheconnectiontotheotherdevice and then start the ...
-
Samsung Q45c - page 185
184 Q There is no sound or sound is intermittently interrupted after connecting a headset A1 Ifyourheadsetisa mono headset , check ifamonoheadsetconnectionhasbeen made.Inthiscase,toresolvetheproblem, completetheproceduresbelow . Double-clickovertheBluetoothicon ...
-
Samsung Q45c - page 186
185 HD DVD (Optional) Q Is it compatible with the existing CD/DVD formats? A AllBurning,Playbackand Authoringfunctionsare supportedfortheCD/DVDformats. Q Can I play Blu-Ray titles? A SinceHD-DVDandBlu-Raydiskaredifferent,Blu- Raytitlesarenotsupported. Q Which functions are supported ...
-
Samsung Q45c - page 187
186 Blu-Ray (O ptional) Q Is it compatible with the existing CD/DVD formats? A AllBurning,Playbackand Authoringfunctionsare supportedfortheCD/DVDformats. Q Can I play an HD-DVD title? A SinceHD-DVDandBlu-Raydiskaredifferent,HD- DVDtitlesarenotsupported. Q Which functions for the curr ...
-
Samsung Q45c - page 188
187 Other Q 4GB memory is not recognized by Windows correctly . A Thisisduetoalimitationin32bitoperating systemsthatexistsinnotebookcomputersof othermanufacturers. Althoughtheaddressspace ofthe32bitoperatingsystemis2³²=4294967296 =4,096MB=4GB,all ...
-
Samsung Q45c - page 189
188 Product Specications The system specications may differ depending on the derived models. For detailed system specications, refer to the product catalogue. NP-Q45c/Q46c/P200 CPU * Intel® Core2 Duo Processor , Intel Celeron M Processor Cache Memory * 1MB / 2MB / 3MB / 4MB / 6MB Main Memory * 512MB ~ 2GB, Max 4GB, Memory type : DDR2 SODI ...
-
Samsung Q45c - page 190
189 Wireless LAN Specications (802.1 1BG Card) Atheros Wireless Network Adapter The Name of the Registered Equipment :SpecialLowPowerWirelessDeviceforWirelessDataCommunication Systems. Item Detailed Specications Physical Specications Dimensions 30.0×50.95mm(WidthXHeight) Operating ...
-
Samsung Q45c - page 191
190 Radio Specications RF Band 2.4GHz Supported Channels Channelsallowedpercountry . Device T ransceiver Standard Output Power MAX10mW Modulation Scheme DSSS,CCK,OFDM Data Rate (Mbps) * 1 1bmode:1 1,5.5,2,1 1 1gmode**:54,48,36,24,18,12,9,6 Antenna T ype Built-in Antenna ...
-
Samsung Q45c - page 192
191 Registered T rademarks SamsungisaregisteredtrademarkofSamsungCo.,Ltd. SENSisaregisteredtrademarkofSamsungElectronics Co.,Ltd. Intel,Pentium/Celeronareregisteredtrademarksofthe IntelCorporation. Microsoft,MS-DOS,andWindowsareregistered trademarksof ...
-
Samsung Q45c - page 193
192 Glossary TheGlossaryliststheterminologiesusedinthisUserGuide. Forterminologiesotherthanthese,lookinWindowsHelp. Backup A waytosavethecurrentdatatorestoreitlaterif necessary . A backupisawaytorestorecomputerdata when the data o ...
-
Samsung Q45c - page 194
193 Firewall A securitysystemusedtoprotectaninternalnetworkor intranetfromexternalnetworks through an authentication procedure. Hibernation Mode A powermodethatsavesalldatainmemorytothe harddiskandturnstheCPUandharddiskoff.When cancelingHiber ...
-
Samsung Q45c - page 195
194 Quick Launch Thisreferstoatoolbarthatcanbeconguredsothat youcanlaunchaprogramsuchasInternetExploreror displaytheWindowsDesktopwithoneclick.Y oucan addanyicontothequicklaunchareaoftheT askbar andlaunchfrequentlyu ...
-
Samsung Q45c - page 196
195 USB (UniversalSerialBus) Thisreferstoaserialinterfacestandarddeveloped toreplacetheconventionalinterfacestandardssuch asSerialandPS/2.WhileUSB1.1supports12Mbps (12millionbitspersecond),USB2.0supportsadata ratethatis40times? ...
-
Samsung Q45c - page 197
196 Index A A VStationNow 131 B Battery 144 BatteryCalibration 148 BIOSSetup 135 Bluetooth 105 BootingPriority 141 C CDDrive/Recording 51 Charge 145 Click 49 Connecting AP/ AP 98 Connect/OutputMonitor 61 ControlPanel 82 CyberLinkPowerDV ...
-
Samsung Q45c - page 198
197 Contact SAMSUNG WORLD WIDE [U.S.A. / U.K.] Contact SAMSUNG WORLD WIDE IfyouhaveanycommentsorquestionsregardingaSamsungproducts,contacttheSAMSUNGcustomercare center . Customer Care Center TEL Web Site U.S.A. 1-800-SAMSUNG(726-7864) www .samsung.com/us U.K. 0870-SAMSUNG(726-7864) www .samsung. ...
-
Samsung Q45c - page 199
198 [IT AL Y] Contatta SAMSUNG SehaicommentiorichiestesuiprodottiSamsungcontattailnostroServizioClienti. Customer Care Center TEL Web Site IT AL Y 800-SAMSUNG(726-7864) www .samsung.com/it [RUSSIA / UKRAINE] Customer Care Center TEL Web Site RUSSIA 8-800-555-55-55 www .samsung.ru UKRAINE 8-800-502-0000 www .sa ...
A group of documents referred to as user manuals is also divided into more specific types, such as: Installation manuals Samsung Q45c, service manual, brief instructions and user manuals Samsung Q45c. Depending on your needs, you should look for the document you need. In our website you can view the most popular manual of the product Samsung Q45c.
Similar manuals
A complete manual for the device Samsung Q45c, how should it look like?
A manual, also referred to as a user manual, or simply "instructions" is a technical document designed to assist in the use Samsung Q45c by users. Manuals are usually written by a technical writer, but in a language understandable to all users of Samsung Q45c.
A complete Samsung manual, should contain several basic components. Some of them are less important, such as: cover / title page or copyright page. However, the remaining part should provide us with information that is important from the point of view of the user.
1. Preface and tips on how to use the manual Samsung Q45c - At the beginning of each manual we should find clues about how to use the guidelines. It should include information about the location of the Contents of the Samsung Q45c, FAQ or common problems, i.e. places that are most often searched by users in each manual
2. Contents - index of all tips concerning the Samsung Q45c, that we can find in the current document
3. Tips how to use the basic functions of the device Samsung Q45c - which should help us in our first steps of using Samsung Q45c
4. Troubleshooting - systematic sequence of activities that will help us diagnose and subsequently solve the most important problems with Samsung Q45c
5. FAQ - Frequently Asked Questions
6. Contact detailsInformation about where to look for contact to the manufacturer/service of Samsung Q45c in a specific country, if it was not possible to solve the problem on our own.
Do you have a question concerning Samsung Q45c?
Use the form below
If you did not solve your problem by using a manual Samsung Q45c, ask a question using the form below. If a user had a similar problem with Samsung Q45c it is likely that he will want to share the way to solve it.