Documents that we receive from a manufacturer of a Panasonic DMCZS8K can be divided into several groups. They are, among others:
- Panasonic technical drawings
- DMCZS8K manuals
- Panasonic product data sheets
- information booklets
- or energy labels Panasonic DMCZS8K
All of them are important, but the most important information from the point of view of use of the device are in the user manual Panasonic DMCZS8K.
- UserManuals.org
- Panasonic
- Panasonic Digital Camera
- Panasonic DMCZS8K
Manual Panasonic DMCZS8K
Go to site of 108
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
Summary
-
Panasonic DMCZS8K - page 1
947+ 0 .= %DVLF2ZQHU ¶ V0DQXDO 'LJLWDO&DPHUD 0RGHO1R '0&=6 '0&=6 %HIRUHFRQQHFWLQJRSHUDWLQJRUDGMXVWLQJ WKLVSURGXFWSOHDVHUHDGWKHLQVWUXFWLRQV FRPSOHWHO 0RUHGHWDLOHGLQVWUXFWLRQVRQWKHRSHUDWLRQRI WKLVFDPHUD? ...
-
Panasonic DMCZS8K - page 2
947+(1* 'HDU&XVWRPHU 7KDQNRXIRUFKRRVLQJ3DQDVRQLF < RXKDYHSXUFKDVHGRQHRIWKHPRVWVRSKLVWLFDWHGDQGUHOLDEOHSURGXFWV RQWKHPDUNHWWRGD 8VHGSURSHUO ZH¶UHVXUHLWZLOOEULQJRXDQGRXU IDPLOHDUVRIHQMRPHQ ...
-
Panasonic DMCZS8K - page 3
(1*947+ )&&1RWH 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSOZLWKWKHOLPLWVIRU D&ODVV%GLJLWDOGHYLFHSXUVXDQWWR3DUWRIWKH)&&5XOHV 7KHVH OLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOHSURWHFWLRQD ...
-
Panasonic DMCZS8K - page 4
947+(1* : $51,1* 7 25('8&( 7+(5,6.2)),5((/(&75,&6+2&.25352'8&7 '$0$*( '2127 (;326( 7+,6 $33 $5$ 7867 25$,102,6785('5,33,1* 2563/$6+,1* $1' 7+$ 7122%-(&76),//(&apos ...
-
Panasonic DMCZS8K - page 5
(1*947+ : DUQLQJ 5LVNRIILUHH[SORVLRQDQGEXUQV'RQRWGLVDVVHPEOHKHDWDERYH& )RULQFLQHUDWH Ŷ $ERXWWKHEDWWHUFKDUJHU &$87,21 '2127,167 $//253/$&(7+,681,7,1 $ %22.&$6( ...
-
Panasonic DMCZS8K - page 6
947+(1* &RQWHQWV ,QIRUPDWLRQIRU < RXU6DIHW %HIRUHXVH 6WDQGDUGDFFHVVRULHV 1DPHVRISDUWV &XUVRUEXWWRQ ? ...
-
Panasonic DMCZS8K - page 7
(1*947+ 6WDQGDUGDFFHVVRULHV &KHFNWKDWDOOWKHDFFHVVRULHVDUHVXSSOLHGEHIRUHXVLQJWKHFDPHUD3DUW QXPEHUVDUHDVRI-DQXDU %DWWHUSDFN '0: %&*33 &KDUJHWKHEDWWHU EHIRUHXVH %DWWHUSDFNLVLQGLFDWH ...
-
Panasonic DMCZS8K - page 8
947+(1* 1DPHVRISDUWV &DPHUD212))VZLWFK 6KXWWHUEXWWRQ 0RGHGLDO )ODVK 6HOIWLPHULQGLFDWRU$) $VVLVW/DPS /HQVEDUUHO /HQV /&'PRQLWRU >(;32685(@EXWWRQ >',63 @EXWWRQ >40(18@> @ 'HOHWH5HWXUQEXWWRQ 6SHDNHU 0LFURS ...
-
Panasonic DMCZS8K - page 9
(1*947+ &XUVRUEXWWRQ +DQGVWUDSHHOHW >$ 9287',*,7 $/@VRFNHW 7KHLOOXVWUDWLRQVDQGVFUHHQVLQWKLVPDQXDOPDGLIIHUIURPWKHDFWXDO SURGXFW 7KHLOOXVWUDWLRQLVRIWKH'0&=6 >0(186(7@ PHQXGLVSODVHWILQLVK ...
-
Panasonic DMCZS8K - page 10
947+(1* &KDUJLQJWKHEDWWHU Ŷ $ERXWEDWWHULHVWKDWRXFDQXVHZLWKWKLVXQLW 7KHEDWWHUWKDWFDQEHXVHGZLWKWKLVXQLWLV'0: %&*33 ,WKDVEHHQIRXQGWKDWFRXQWHUIHLWEDWWHUSDFNVZKLFKORRNYHU VLPLODUWRWKH ...
-
Panasonic DMCZS8K - page 11
(1*947+ Ŷ 5HFRUGLQJFDSDFLWJXLGHOLQHVSLFWXUHVUHFRUGLQJWLPH 1XPEHURIUHFRUGDEOH SLFWXUHV $SSUR[SLFWXUHV 5HFRUGLQJWLPH $SSUR[PLQ 3ODEDFNWLPH $SSUR[PLQ 5HFRUGLQJFRQGLWLRQVE&,3 $ VWDQGDUG &,3 ...
-
Panasonic DMCZS8K - page 12
(1*947+ 3LFWXUHVDYHGHVWLQDWLRQFDUGVDQGEXLOWLQPHPRU Ŷ %XLOWLQPHPRUDSSUR[0% Ɣ 7KHEXLOWLQPHPRUFDQEHXVHGDVDWHPSRUDUVWRUDJHGHYLFHZKHQ WKHFDUGEHLQJXVHGEHFRPHVIXOO Ɣ 7KHDFFHVVWLPH? ...
-
Panasonic DMCZS8K - page 13
947+(1* ,QVHUWLQJDQGUHPRYLQJWKHFDUG RSWLRQDOWKHEDWWHU Ŷ 7 RUHPRYH 7 RUHPRYHEDWWHU PRYHOHYHULQGLUHFWLRQRIDUURZ 7 RUHPRYHFDUG SUHVVGRZQLQFHQWHU /HYHU Ɣ $OZDVXVHJHQXLQH3DQDVRQLFEDWWHULHV& ...
-
Panasonic DMCZS8K - page 14
947+(1* 6HWWLQJWKHFORFN 7KHFORFNLVQRWVHWZKHQWKHFDPHUDLVVKLSSHG 7 XUQRQWKHSRZHU 3UHVV>0(186(7@ ZKLOH WKHPHVVDJHLVGLVSODHG 3UHVVŻŹWRVHOHFWWKHLWHPV HDU PRQWKGD KRXU PLQXWH GLV ...
-
Panasonic DMCZS8K - page 15
(1*947+ 6HWWLQJWKHPHQX 5HIHUWRWKHIROORZLQJSURFHGXUHVWRRSHUDWHWKHPHQXV ([DPSOH 6HWWLQJ>/&'0RGH@IURP>2))@WR LQWKH>3URJUDP $(@ 0RGH 3UHVV>0(186(7@WRGLVSODWKHPHQX 6ZLWFKLQJWRWKH>6HWXS@ ...
-
Panasonic DMCZS8K - page 16
947+(1* 6HOHFWLQJWKH5HFRUGLQJ0RGH 7 XUQRQWKHSRZHU 6OLGHWKH>5(&3/$ <@VZLWFK WR 6ZLWFKLQJWKHPRGHEURWDWLQJ WKHPRGHGLDO >,QWHOOLJHQW $XWR@0RGH 7 DNHSLFWXUHVZLWKDXWRPDWLFVHWWLQJV >3URJUDP $( ...
-
Panasonic DMCZS8K - page 17
(1*947+ 7 DNLQJSLFWXUHVZLWKDXWRPDWLFVHWWLQJV >,QWHOOLJHQW $XWR@0RGH 5HFRUGLQJ0RGH 2SWLPXPVHWWLQJVDUHPDGHDXWRPDWLFDOOIURPLQIRUPDWLRQVXFKDV ³IDFH´³PRYHPHQW´³EULJKWQHVV´DQG³GLVWDQFH´MXVWESRLQWLQJWKH FDPHUDDW ...
-
Panasonic DMCZS8K - page 18
947+(1* 7 DNLQJSLFWXUHVZLWKDXWRPDWLFVHWWLQJV >,QWHOOLJHQW $XWR@0RGH &RQWLQXHG 5HFRUGLQJ0RGH Ŷ $XWRPDWLF6FHQH'HWHFWLRQ &DPHUDLGHQWLILHVVFHQHZKHQSRLQWHGDWVXEMHFWDQGPDNHVRSWLPXP VHWWLQJVDXWRPDWLFDOO 7KHWSH ...
-
Panasonic DMCZS8K - page 19
(1*947+ 7 DNLQJPRWLRQSLFWXUHV >0RWLRQ3LFWXUH@0RGH 5HFRUGLQJ0RGH 7KLVUHFRUGVPRWLRQSLFWXUHVZLWKDXGLR5HFRUGLQJZLWKPXWHGVRXQGLV QRWSRVVLEOH6RXQGUHFRUGLQJLVPRQDXUDO'0&=6RUVWHUHR'0& =6 ...
-
Panasonic DMCZS8K - page 20
947+(1* 9 LHZLQJRXUSLFWXUHV >1RUPDO3OD@ 3ODEDFN0RGH 'HOHWLQJSLFWXUHV 3ODEDFN0RGH 6OLGHWKH>5(&3/$ <@VZLWFK WR 3UHVVŻŹWRVHOHFWWKHSLFWXUH Ɣ 7 RSODEDFNDPRWLRQSLFWXUHVHOHFWDQLPDJH ...
-
Panasonic DMCZS8K - page 21
(1*947+ 5HDGLQJWKH2ZQHU ¶ V0DQXDO 3')IRUPDW 0RUHGHWDLOHGLQVWUXFWLRQVRQWKHRSHUDWLRQRIWKLVFDPHUDDUHFRQWDLQHG LQ³2ZQHU ¶ V0DQXDOIRUDGYDQFHGIHDWXUHV3')IRUPDW´LQWKHVXSSOLHG &'520,QVWDOO ...
-
Panasonic DMCZS8K - page 22
947+(1* 5HDGLQJWKH2ZQHU ¶ V0DQXDO 3')IRUPDW &RQWLQXHG Ŷ :KHQWKH2ZQHU ¶ V0DQXDO3')IRUPDWZLOOQRWRSHQ < RXZLOOQHHG $GREH $FUREDW5HDGHURUODWHURU $GREH5HDGHU RUODWHUWR? ...
-
Panasonic DMCZS8K - page 23
(1*947+ 6SHFLILFDWLRQV 'LJLWDO&DPHUD ,QIRUPDWLRQIRURXUVDIHW 3RZHU6RXUFH '&9 3RZHU &RQVXPSWLRQ :KHQUHFRUGLQJ: :KHQSODLQJEDFN: &DPHUDHIIHFWLYH SL[HOV SL[HOV ,PD ...
-
Panasonic DMCZS8K - page 24
947+(1* 6SHFLILFDWLRQV &RQWLQXHG +LVSHHGEXUVW %XUVWVSHHG $SSUR[SLFWXUHVVHFRQG6SHHGSULRULW $SSUR[SLFWXUHVVHFRQG,PDJHSULRULW 1XPEHURI UHFRUGDEOH SLFWXUHV $SSUR[SLFWXUHV:KHQXVLQJWKHEXLOWLQ? ...
-
Panasonic DMCZS8K - page 25
(1*947+ ,QWHUIDFH 'LJLWDO 86%+LJK6SHHG $QDORJYLGHR 176&&RPSRVLWH $XGLR $XGLROLQHRXWSXW0RQDXUDO 7 HUPLQDO $ 9287',*,7 $/'HGLFDWHGMDFNSLQ 'LPHQVLRQV $SSUR[PP:[? ...
-
Panasonic DMCZS8K - page 26
947+(1* 2SWLRQDODFFHVVRULHV 3URGXFWQDPH %DWWHU3DFN 3URGXFWQR '0:%&*33 Ɣ 3HUIRUPDQFHLGHQWLFDOWRVXSSOLHGEDWWHUSDFN Ɣ 5HFRPPHQGHGIRUWDNLQJRQKROLGD HWF 3URGXFWQDPH $&DGDSWRU 3URGXFWQR ...
-
Panasonic DMCZS8K - page 27
(1*947+ 'LJLWDO&DPHUD $FFHVVRU2UGHU)RUP 3OHDVHSKRWRFRSWKLVIRUPZKHQSODFLQJDQRUGHU 'LJLWDO&DPHUD0RGHO ...
-
Panasonic DMCZS8K - page 28
947+(1* /LPLWHG: DUUDQW 21/ < )2586$ $1'38(57 25,&2 3DQDVRQLF&RQVXPHU(OHFWURQLFV&RPSDQ 'LYLVLRQRI3DQDVRQLF&RUSRUDWLRQRI1RUWK $PHULFD 2QH3DQDVRQLF: D 6HFDXFXV1HZ-HUVH 3DQD ...
-
Panasonic DMCZS8K - page 29
(1*947+ 0DLO,Q6HUYLFH )RUDVVLVWDQFHLQWKH86$DQG3XHUWR5LFRLQREWDLQLQJUHSDLUVSOHDVHVKLSWKH SURGXFWSUHSDLGWR 3DQDVRQLF([FKDQJH&HQWHU *HRUJH0F9 D'ULYH 6XLWH% 0F$OOHQ7; SDQDFDUH#XVSDQ ...
-
Panasonic DMCZS8K - page 30
947+(1* 7+(5( $5(12(;35(66: $55$17,(6(;&(37 $6/,67('81'(5 ³/,0,7(': $55$17<&29(5$*(´ 7+(: $55$1725,6127/,$%/()25,1&,'(17 $/25&216(48(17,$/ '$0$*(65(68/ 7,1*)5207+(86(2)7+,6352'8&am ...
-
Panasonic DMCZS8K - page 31
(1*947+ &XVWRPHU6HUYLFHV'LUHFWRU8QLWHG6WDWHVDQG3XHUWR5LFR 2EWDLQ3URGXFW,QIRUPDWLRQDQG2SHUDWLQJ $VVLVWDQFHORFDWHRXUQHDUHVW 'HDOHURU6HUYLFH&HQWHUSXUFKDVH3DUWVDQG $FFHVVRULHVRUPDNH &XVWRPHU6HUYLFH ...
-
Panasonic DMCZS8K - page 32
6';&/RJRLVDWUDGHPDUNRI6'&//& 4XLFN7 LPHDQGWKH4XLFN7 LPHORJRDUHWUDGHPDUNVRU UHJLVWHUHGWUDGHPDUNVRI $SSOH,QFXVHGXQGHUOLFHQVH WKHUHIURP 7KLVSURGXFWXVHV³'QD)RQW´IURP'QD&RPZDUH &R ...
-
Panasonic DMCZS8K - page 33
Owner ’ s Manual for advanced features Digital Camera Model No. DMC-ZS9 DMC-ZS8/ DMC-TZ18 Before connecting, operating or adjusting this product, please read the instructions completely . VQT3H43 ...
-
Panasonic DMCZS8K - page 34
2 VQT3H43 VQT3H43 3 Contents Before use Before use .............................................. 5 Standard Accessories ........................... 7 Names of parts....................................... 8 Cursor button ................................................ 8 Preparations Charging the battery ............................. 9 Guidelines f ...
-
Panasonic DMCZS8K - page 35
4 VQT3H43 VQT3H43 5 Contents (Continued) Before use Ŷ Camera handling Keep the camera away from excessive vibration, force, or pressure. Ɣ Avoid using the camera under the following conditions, which may damage the lens, LCD monitor , or camera body . This may also cause the camera to malfunction or prevent recording. • Dropping or hitting the ...
-
Panasonic DMCZS8K - page 36
6 VQT3H43 VQT3H43 7 Before use (Continued) Standard Accessories Ŷ Always take a test shot first Before important events when you will use the camera (at weddings, for example), always take a test shot to make sure that pictures and sound record correctly . Ŷ No compensation for missed shots We cannot compensate for missed shots if technical probl ...
-
Panasonic DMCZS8K - page 37
8 VQT3H43 VQT3H43 9 Names of parts Charging the battery Always charge before first use! (battery shipped uncharged) Cursor button Left cursor button ( Ż ) • Self-timer ( ĺ 45) Down cursor button ( ź ) • Macro Mode ( ĺ 42) • AF Lock (AF T racking) ( ĺ 29, 74) Up cursor button ( Ÿ ) • Exposure Compensation ( ĺ 46) • Auto Bracket ( ĺ ...
-
Panasonic DMCZS8K - page 38
10 VQT3H43 VQT3H43 1 1 Charging the battery (Continued) Guidelines for the number of recordable pictures and operating time The number of recordable pictures or available operating time may vary according to surrounding environment and usage conditions. Figures may be reduced if flash, zoom, or other functions are used frequently , or in colder cli ...
-
Panasonic DMCZS8K - page 39
12 VQT3H43 VQT3H43 13 Inserting and removing the card (optional)/ the battery Set the camera ON/OFF switch to OFF Slide to the [OPEN] position and open the lid [OPEN] [LOCK] Release lever Insert the battery and card, making sure that their orientation is correct • Battery: Insert all the way firmly until a locking sound is heard, and check that t ...
-
Panasonic DMCZS8K - page 40
14 VQT3H43 VQT3H43 15 Inserting and removing the card (optional)/ the battery (Continued) Remaining battery and memory capacity Displayed when no card is inserted (pictures will be saved to built-in memory) Estimated remaining pictures or recording time capacity (press [DISP .] button to switch display) Remaining battery (only when using battery) ( ...
-
Panasonic DMCZS8K - page 41
16 VQT3H43 VQT3H43 17 Setting the clock ( The clock is not set when the camera is shipped.) Setting the menu Set REC/PLA Y switch to before turning on the power . T o change time setting Select [Clock Set] from the [Setup] menu, perform and . • Clock settings will be saved for approx. 3 months even after battery is removed, provided a fully-charg ...
-
Panasonic DMCZS8K - page 42
18 VQT3H43 VQT3H43 19 Using the [Setup] menu Setting the menu (Continued) Menu type [Rec] menu (REC/PLA Y switch: ) [Motion Picture] menu (REC/PLA Y switch: ) Changing picture preferences ( ĺ 70 - 82) • Displays settings such as White Balance, Sensitivity , Aspect Ratio, and Picture Size. [Setup] menu (REC/PLA Y switch: ) Making the camera more ...
-
Panasonic DMCZS8K - page 43
20 VQT3H43 VQT3H43 21 For details about the setting procedure in the [Setup] menu ( ĺ 17) Using the [Setup] menu (Continued) Item Settings, notes [Cust.Set Mem.] Register settings on current camera. ( ĺ 51) [C1] / [C2] / [C3] [LCD Mode] Make LCD monitor easier to see. [Auto Power LCD]: The brightness is adjusted automatically depending on how bri ...
-
Panasonic DMCZS8K - page 44
22 VQT3H43 VQT3H43 23 For details about the setting procedure in the [Setup] menu ( ĺ 17) Using the [Setup] menu (Continued) Item Settings, notes [No.Reset] Reset picture file numbers. • The folder number is updated and the file number starts from 0001. • A folder number between 100 and 999 can be assigned. Numbers cannot be reset once folder ...
-
Panasonic DMCZS8K - page 45
24 VQT3H43 VQT3H43 25 Using the [Setup] menu (Continued) Basic shooting operation For details about the setting procedure in the [Setup] menu ( ĺ 17) Item Settings, notes [Language] Change display language. Set the language displayed on the screen. [Demo Mode] View demonstration of functions. [Stabilizer Demo.]: Extent of jitter is shown on graph ...
-
Panasonic DMCZS8K - page 46
26 VQT3H43 VQT3H43 27 Basic shooting operation (Continued) T aking pictures with automatic settings [Intelligent Auto] Mode Recording Mode: Mode dial [Intelligent Auto] Mode T ake pictures with automatic settings. ( ĺ 27) [Program AE] Mode Record pictures with your own settings. ( ĺ 30) [Aperture-Priority] Mode Determine aperture, then record pic ...
-
Panasonic DMCZS8K - page 47
28 VQT3H43 VQT3H43 29 T aking pictures with automatic settings [Intelligent Auto] Mode (Continued) Recording Mode: Ŷ T o use flash Select either (Auto) or (Forced Flash Off). • When is used, , (Auto/Red-Eye Reduction), (Slow Sync./Red-Eye Reduction) and (Slow Sync.) are selected automatically according to the subject type and brightness. For det ...
-
Panasonic DMCZS8K - page 48
30 VQT3H43 VQT3H43 31 T aking pictures with your own settings [Program AE] Mode Recording Mode: Aligning the focus Ɣ If a warning is displayed about jitter , use [Stabilizer], a tripod, or [Selftimer]. Ɣ If aperture and shutter speed are shown in red, you do not have appropriate exposure. Y ou should either use the flash, change [Sensitivity] set ...
-
Panasonic DMCZS8K - page 49
32 VQT3H43 VQT3H43 33 T aking pictures with zoom Recording Mode: Zoom In/Out Capture a wider area (wide-angle) Enlarge the subject (telephoto) Focus range Zoom ratio (approx.) Zoom bar Ɣ Zoom speed can be adjusted. Zoom slowly ĺ turn slightly Zoom quickly ĺ turn completely Y ou can zoom in up to 16 times with “Optical Zoom”, and up to 33.8 t ...
-
Panasonic DMCZS8K - page 50
34 VQT3H43 VQT3H43 35 T aking pictures with zoom (Continued) Recording Mode: [i.ZOOM] The camera uses super resolution technology to increase the zoom ratio. Using super resolution technology , the zoom ratio can be increased up to about 1.3 times higher than the original zoom ratio with almost no deterioration of picture quality . Display the [Rec ...
-
Panasonic DMCZS8K - page 51
36 VQT3H43 VQT3H43 37 T aking pictures with zoom (Continued) Recording Mode: V i ewing your pictures [Normal Play] Playback Mode: [Digital Zoom] Zoom 4 times further than Optical/Extended Optical Zoom. (Note that, with Digital Zoom, enlarging will decrease picture quality .) Display the [Rec] menu Select [ON] Select [Digital Zoom] Press [ / ] sever ...
-
Panasonic DMCZS8K - page 52
38 VQT3H43 VQT3H43 39 Deleting pictures Playback Mode: Changing recording information display Select type of deletion • T o use [Delete All] ĺ go to step Select the pictures to delete (Repeat) • T o release ĺ Press [DISP .] again Picture selected Pictures will be deleted from the card if the card is inserted, or from the built-in memory if th ...
-
Panasonic DMCZS8K - page 53
40 VQT3H43 VQT3H43 41 T aking pictures with flash Recording Mode: Display [Flash] Select the desired type T ype, operations Uses [Auto] • Automatically judges whether or not to flash Normal use [Auto/Red-Eye] 1 • Automatically judges whether or not to flash (reduce red-eye) T aking pictures of subjects in dark places [Forced Flash On] • A ...
-
Panasonic DMCZS8K - page 54
42 VQT3H43 VQT3H43 43 T aking close-up pictures Recording Mode: When you want to enlarge the subject, setting to [AF Macro] ( ) enables you to take pictures at an even closer distance than the normal focus range (up to 3 cm (0.10 feet) for max. W). Display [Macro Mode] Select [AF Macro] T ake a picture display T aking close-up pictures without stan ...
-
Panasonic DMCZS8K - page 55
44 VQT3H43 VQT3H43 45 Positioning camera and subject within accessible range for focus alignment T aking pictures with self-timer Recording Mode: We recommend using a tripod. This is also effective for correcting jitter when pressing the shutter button, by setting the self-timer to 2 seconds. Ɣ Focus will be automatically adjusted immediately befo ...
-
Panasonic DMCZS8K - page 56
46 VQT3H43 VQT3H43 47 Corrects exposure to obtain optimum exposure (for example, if there is difference between bringhtness of object and background). Ɣ Depending on the brightness, this may not be possible in some cases. Ɣ After exposure adjustment, the adjustment value ( for example) is displayed. Ɣ The Exposure Compensation value you set is r ...
-
Panasonic DMCZS8K - page 57
48 VQT3H43 VQT3H43 49 When recording, you can control the range of focus (depth of field) to meet your recording purposes. Shutter speed is automatically adjusted to be appropriate for the set aperture value. Set to ([Aperture-Priority] Mode) Determine aperture value • When the aperture value is increased, the range of depth in focus expands, and ...
-
Panasonic DMCZS8K - page 58
50 VQT3H43 VQT3H43 51 This mode of recording lets you set any aperture value and shutter speed when exposure adjustment prevents you from recording at the desired exposure (brightness/darkness). Also, long-exposure recording of up to 60 seconds is possible. Set to ([Manual Exposure] Mode) • Manual exposure assist is displayed. Determine aperture ...
-
Panasonic DMCZS8K - page 59
52 VQT3H43 VQT3H43 53 T aking pictures according to the scene [Scene Mode] Recording Mode: [Custom] Switch to your own settings and record Settings registered in [Cust.Set Mem.] can be quickly called up by setting the mode dial to . Set to (Custom Mode) Select custom set •U s e ŻŹ to switch between screens. Ɣ Even if [Rec] menu, etc. is change ...
-
Panasonic DMCZS8K - page 60
54 VQT3H43 VQT3H43 55 How to select a scene ( ĺ 53) Using flash in Scene Modes ( ĺ 41) T aking pictures according to the scene [Scene Mode] (Continued) Recording Mode: Scene Uses, Tips Notes [Portrait] Improves the skin tone of subjects for a healthier appearance in bright daylight conditions. T ips • Stand as close as possible to subject. • ...
-
Panasonic DMCZS8K - page 61
56 VQT3H43 VQT3H43 57 How to select a scene ( ĺ 53) Using flash in Scene Modes ( ĺ 41) T aking pictures according to the scene [Scene Mode] (Continued) Recording Mode: Scene Uses, Tips Notes [Food] T akes natural-looking pictures of food. í [Party] Brighten subjects and background in pictures of indoor events, such as weddings. T ips • Stand a ...
-
Panasonic DMCZS8K - page 62
58 VQT3H43 VQT3H43 59 How to select a scene ( ĺ 53) Using flash in Scene Modes ( ĺ 41) T aking pictures according to the scene [Scene Mode] (Continued) Recording Mode: Scene Uses, Tips Notes [Fireworks] T akes clear pictures of fireworks in the night sky . T ips • Stand at least 10 m (32.8 feet) away . • T ripod recommended. • Shutter speed ...
-
Panasonic DMCZS8K - page 63
60 VQT3H43 VQT3H43 61 Saving commonly used scenes [My Scene Mode] Recording Mode: T aking motion pictures [Motion Picture] Mode Recording Mode: Ɣ and Both represent the same function. Frequently-used scenes can be preset to each position so that you can quickly and easily switch to the desired Scene Mode. Ɣ If recording settings are reset by [Res ...
-
Panasonic DMCZS8K - page 64
62 VQT3H43 VQT3H43 63 T aking motion pictures [Motion Picture] Mode (Continued) Recording Mode: Recording with the Face Recognition function [Face Recog.] Recording Mode: [Rec Quality] Changing the motion picture size. When recording a motion picture, use a card rated with an SD speed class 1 of “Class 6” or higher . 1 SD speed class re ...
-
Panasonic DMCZS8K - page 65
64 VQT3H43 VQT3H43 65 Recording with the Face Recognition function [Face Recog.] (Continued) Recording Mode: For [Rec] menu setting procedures ( ĺ 17) Registering face pictures Up to 6 people’s face pictures can be registered along with such information as name and birth date. Y ou can facilitate Face Recognition by the way you register faces: f ...
-
Panasonic DMCZS8K - page 66
66 VQT3H43 VQT3H43 67 Recording with the Face Recognition function [Face Recog.] (Continued) Recording Mode: For [Rec] menu setting procedures ( ĺ 17) Editing or deleting information about registered persons Information about registered people can be edited or deleted. Select [Face Recog.] from the [Rec] menu ( ĺ 17) Select [MEMOR Y] with Ÿź , ...
-
Panasonic DMCZS8K - page 67
68 VQT3H43 VQT3H43 69 Useful features for travel For [Setup] menu setting procedures ( ĺ 17) [W orld Time] Set the recording date and time with the local time at your destination. Ŷ Recording Mode: Select [World T ime] from the [Setup] menu ( ĺ 17) • [Please set the home area] will be displayed when setting for the first time. In this case, pr ...
-
Panasonic DMCZS8K - page 68
70 VQT3H43 VQT3H43 71 For [Rec] menu setting procedures ( ĺ 17) Using the [Rec] menu [Quality] Set quality of picture. Ŷ Recording Mode: Ŷ Settings: Fine (High quality , priority to picture quality) Standard (Standard quality , priority to the number of pictures) Ɣ The setting is fixed to (Standard) in the following Scene Modes. ([T ransform], ...
-
Panasonic DMCZS8K - page 69
72 VQT3H43 VQT3H43 73 For [Rec] menu setting procedures ( ĺ 17) Using the [Rec] menu (Continued) Ŷ White Balance fine adjustment (excluding [A WB]) White Balance settings can be individually fine tuned if colors still do not appear as anticipated. Select the white balance to be fine-tuned, and press the [DISP .] button to display the [WB Adjust.] ...
-
Panasonic DMCZS8K - page 70
74 VQT3H43 VQT3H43 75 For [Rec] menu setting procedures ( ĺ 17) Using the [Rec] menu (Continued) Ɣ In [Starry Sky] and [Fireworks] Scene Modes, the AF Mode setting is fixed to (1-area-focusing). Ɣ Use (1-area-focusing) if focus is difficult to align with (Spot-focusing). Ɣ Cannot set to (Face Detection) in the following cases: [Panorama Assist] ...
-
Panasonic DMCZS8K - page 71
76 VQT3H43 VQT3H43 77 For [Rec] menu setting procedures ( ĺ 17) Using the [Rec] menu (Continued) [i.Exposure] Automatically adjusts contrast and exposure to give more lifelike colors when there is significant contrast between background and subject. Ŷ Recording Mode: Ŷ Settings: [LOW]/[ST ANDARD]/[HIGH]/[OFF] Ɣ [LOW], [ST ANDARD] and [HIGH] ind ...
-
Panasonic DMCZS8K - page 72
78 VQT3H43 VQT3H43 79 For [Rec] menu setting procedures ( ĺ 17) Using the [Rec] menu (Continued) [Digital Zoom] Multiplies effect of Optical Zoom or Extended Optical Zoom by up to 4 times. For details ( ĺ 36) Ŷ Recording Mode: Ŷ Settings: [ON]/[OFF] Ɣ This is fixed to [ON] when [Macro Zoom] is set. [Burst] Enables a rapid succession of still p ...
-
Panasonic DMCZS8K - page 73
80 VQT3H43 VQT3H43 81 For [Rec] menu setting procedures ( ĺ 17) Using the [Rec] menu (Continued) [AF Assist Lamp] Illuminates lamp when dark to facilitate focus alignment. Ŷ Recording Mode: Ŷ Settings: [ON] : Lamp illuminated with halfway press of shutter button ( and larger AF area displayed) AF Assist Lamp [OFF] : Lamp off (taking pictures of ...
-
Panasonic DMCZS8K - page 74
82 VQT3H43 VQT3H43 83 Using the [Rec] menu for motion pictures Recording Mode: Using Quick menu For [Rec] menu setting procedures ( ĺ 17) [Rec Quality] For details ( ĺ 62) [Continuous AF] Either allows the focus to be constantly adjusted during motion picture recording, or fixes the focus position at the start of recording. Ŷ Settings: [ON] : Ad ...
-
Panasonic DMCZS8K - page 75
84 VQT3H43 VQT3H43 85 Entering T ext V i ewing as list (Multi Playback/Calendar Playback) Playback Mode: Use the cursor buttons to enter names with the Face Recognition function and in Scene Modes [Baby] and [Pet], or to register destinations in [T ravel Date] etc. Ɣ A maximum of 30 characters can be entered. (Maximum of 9 characters for [Face Rec ...
-
Panasonic DMCZS8K - page 76
86 VQT3H43 VQT3H43 87 W atching motion pictures Playback Mode: Different playback methods [Playback Mode] Playback Mode: Motion pictures can be played back just as you view still pictures. Ŷ Operations during motion picture playback Ÿ :Pause/play ź :Stop Ż : Fast rewind (2 steps) Single-frame rewind (while paused) Ź : Fast forward (2 steps) Si ...
-
Panasonic DMCZS8K - page 77
88 VQT3H43 VQT3H43 89 Different playback methods [Playback Mode] (Continued) Playback Mode: For switching [Playback Mode] procedure ( ĺ 87) [Slide Show] Automatically plays back still pictures in order and to music. Recommended when viewing on TV screen. Select the playback method • [All] • [Picture Only] • [Video Only] • [T ravel] : Play ...
-
Panasonic DMCZS8K - page 78
90 VQT3H43 VQT3H43 91 Different playback methods [Playback Mode] (Continued) Playback Mode: Using the [Playback] menu Playback Mode: For switching [Playback Mode] procedure ( ĺ 87) [Filtering Play] Y ou can refine the selection of pictures to be viewed by narrowing them down to pictures in selected categories or to favourite pictures, and then vie ...
-
Panasonic DMCZS8K - page 79
92 VQT3H43 VQT3H43 93 Using the [Playback] menu (Continued) Playback Mode: For the [Playback] menu setting procedure ( ĺ 17) Ŷ Uploading to image-sharing websites When setting [Upload Set], the built-in uploading tool automatically makes copies on the card inside the camera. Connect the camera to your computer ( ĺ 103) before performing uploadin ...
-
Panasonic DMCZS8K - page 80
94 VQT3H43 VQT3H43 95 Using the [Playback] menu (Continued) Playback Mode: For the [Playback] menu setting procedure ( ĺ 17) Ŷ Items that can be stamped [Shooting Date] [W/O TIME]: Stamp the recording date [WITH TIME]: Stamp the recording date and time [Name] : Stamp name registered in Face Recognition : Stamp name registered in [Baby] or [Pet] [ ...
-
Panasonic DMCZS8K - page 81
96 VQT3H43 VQT3H43 97 Using the [Playback] menu (Continued) Playback Mode: For the [Playback] menu setting procedure ( ĺ 17) [Cropping] Enlarge your still pictures and crop unwanted areas. Press ŻŹ to select a still picture, and then press [MENU/SET] Select area to crop Expand Change position Crop Press Ż to select [Y es], and then press [MENU/ ...
-
Panasonic DMCZS8K - page 82
98 VQT3H43 VQT3H43 99 Using the [Playback] menu (Continued) Playback Mode: For the [Playback] menu setting procedure ( ĺ 17) [Print Set] Picture/picture no./date printing settings can be made for when printing with DPOF print- compatible shops or printers. (Ask at shop to check compatibility) For more information visit: http://panasonic.jp/dc/dpof ...
-
Panasonic DMCZS8K - page 83
100 VQT3H43 VQT3H43 101 Using the [Playback] menu (Continued) Playback Mode: For the [Playback] menu setting procedure ( ĺ 17) [Face Rec Edit] Edit or delete the recognition information for pictures with mistaken Face Recognition. Select [REPLACE] or [DELETE] Select the picture Select a person • If [DELETE], go to step • People whose Face Reco ...
-
Panasonic DMCZS8K - page 84
102 VQT3H43 VQT3H43 103 Using with your PC Still/motion pictures can be copied from the camera to your computer by connecting the two together . • Some computers can read directly from the camera’s memory card. For details, see the manual for your computer . • If your computer does not support SDXC Memory Cards, a message will be displayed re ...
-
Panasonic DMCZS8K - page 85
104 VQT3H43 VQT3H43 105 Using with your PC (Continued) 1 New folders are created in the following cases: • When pictures are taken to folders containing files numbered 999. • When using cards already containing the same folder number (for example, pictures taken with other cameras, etc.) • When recording after performing [No.Reset]. 2 ...
-
Panasonic DMCZS8K - page 86
106 VQT3H43 VQT3H43 107 Some printers can print directly from the camera’s memory card. For details, see the manual for your printer . Printing Ŷ T o cancel print Press [MENU/SET]. Ɣ Do not use any other USB connection cables except the supplied one. Ɣ Disconnect USB connection cable after printing. Ɣ T urn off power before inserting or remov ...
-
Panasonic DMCZS8K - page 87
108 VQT3H43 VQT3H43 109 Printing (Continued) Viewing on TV screen Making print settings on the camera (Make settings before selecting [Print start]) Select item Select setting Item Settings [Print with Date] [ON]/[OFF] [Num.of prints] Set number of pictures (up to 999 pictures) [Paper Size] (printer takes priority) [L/3.5”×5”] (89×127 mm) [2L ...
-
Panasonic DMCZS8K - page 88
1 10 VQT3H43 VQT3H43 1 1 1 Press the [DISP .] button to change display ( ĺ 39). List of LCD monitor displays In recording 1 Recording Mode ( ĺ 26) 2 Picture Size ( ĺ 70) Recording quality ( ĺ 62) 3 Quality ( ĺ 71) Flash ( ĺ 40) Optical Image Stabilizer ( ĺ 80)/ Jitter alert ( ĺ 30) White Balance ( ĺ 72) Color Mode ( ĺ 79) 4 Battery capaci ...
-
Panasonic DMCZS8K - page 89
1 12 VQT3H43 VQT3H43 1 13 Meanings of and required responses to major messages displayed on LCD monitor . Message displays [This memory card cannot be used] Ɣ A MultiMediaCard was inserted. ĺ Not compatible with the camera. Use a compatible card. [Some pictures cannot be deleted] [This picture cannot be deleted] Ɣ Non-DCF pictures ( ĺ 37) canno ...
-
Panasonic DMCZS8K - page 90
1 14 VQT3H43 VQT3H43 1 15 T ry checking these items ( ĺ 1 14 - 1 19) first. (Restoring menu settings to default values may solve certain problems. T ry using [Reset] in [Setup] menu in Recording Mode ( ĺ 22).) Q&A T roubleshooting Battery , power Camera does not work even if power is turned on. Ɣ Battery is not inserted correctly ( ĺ 12), o ...
-
Panasonic DMCZS8K - page 91
1 16 VQT3H43 VQT3H43 1 17 Q&A T roubleshooting (Continued) LCD monitor LCD monitor dims during motion picture recording. Ɣ LCD monitor may dim if continuing motion picture recording for long periods. Brightness is unstable. Ɣ Aperture value is set while shutter button is pressed halfway . (Does not affect recorded picture.) This symptom may a ...
-
Panasonic DMCZS8K - page 92
1 18 VQT3H43 VQT3H43 1 19 Q&A T roubleshooting (Continued) TV , computer , printer No image appears on TV . Image blurred or not colored. Ɣ Not connected correctly ( ĺ 109). Ɣ The television has not been switched to auxiliary input. Ɣ Check the [Video Out] setting (NTSC/P AL) on the camera. (DMC-ZS8PU/DMC-TZ18PR only .) ( ĺ 23) TV screen d ...
-
Panasonic DMCZS8K - page 93
120 VQT3H43 VQT3H43 121 Usage cautions and notes When in use Ɣ Camera may become warm if used for long periods of time, but this is not a fault. Ɣ Keep the camera as far away as possible from electromagnetic equipment (such as microwave ovens, TVs, video games etc.). • If you use the camera on top of or near a TV , the pictures and sound on the ...
-
Panasonic DMCZS8K - page 94
122 VQT3H43 VQT3H43 123 Usage cautions and notes (Continued) Lens Ɣ If lens is dirty: Images may appear slightly white if lens is dirty (fingerprints, etc.). T urn the power on, hold the extracted lens barrel with your fingers, and gently wipe the lens surface with a soft, dry cloth. Ɣ Do not leave the lens exposed to direct sunlight. Ɣ Do not t ...
-
Panasonic DMCZS8K - page 95
• SDXC Logo is a trademark of SD-3C, LLC. • Q uickT ime and the QuickT ime logo are trademarks or registered trademarks of Apple Inc., used under license therefrom. • Y ouTube is a trademark of Google Inc. • T his product uses “DynaFont” from DynaComware Corporation. DynaFont is a registered trademark of DynaComware T aiwan Inc. • Oth ...
-
Panasonic DMCZS8K - page 96
Installing supplied software In these instructions, the supplied software in the CD-ROM is described. If you have questions about any of the supplied software, contact the appropriate support center. • Before inserting the CD-ROM, close all running applications. I For Windows 1 Insert the CD-ROM with the supplied software. When you insert the sup ...
-
Panasonic DMCZS8K - page 97
3 Click on the [Recommended Installation]. • All necessary software will be installed. (Super LoiloScope will only install a shortcut to the trial version download site.) • Only the software compatible with the PC in use will be displayed. • Proceed with installation according to messages appearing on the screen. • If you do not need to ins ...
-
Panasonic DMCZS8K - page 98
Super LoiloScope 30 day full trial version (Windows XPNista/7) Super LoiLoScope is a video editing software that draws out the full power of your PC. Creating videos is as easy as organizing cards on top of a desk. Use your music, picture and video files to create videos to share with your friends and family by burning it to a DVD, uploading it to ...
-
Panasonic DMCZS8K - page 99
Operating environment PC OS Display RAM 6 VQC8055 (ENG) Windows®xp IBM® PC/AT compatible personal computer having Intel® Pentium® Ill 500 MHz or higher CPU (including compatible CPU) Preinstalled Windows Vista® IBM® PC/AT compatible personal computer having Intel® Pentium® Ill 800 MHz or higher CPU (including compatible CPU) Windows® 7 IBM ...
-
Panasonic DMCZS8K - page 100
• Log on with an administrator account or standard user account before using this software. You cannot use this software with a guest account. • When 2 or more USB devices are connected to a PC, or when devices are connected through USB hubs or by using extension cables, proper operation is not guaranteed. • Operation on Windows Vista®fWindo ...
-
Panasonic DMCZS8K - page 101
Cautions for Use • Please do not disconnect the USB connection cable when Software (supplied) is in use. The software may not function correctly and damage the data being transmitted. • When the access indication of the digital camera is lit or flashing, please do not disconnect the USB connection cable. The software may not function correctly ...
-
Panasonic DMCZS8K - page 102
Quicklime QuickTime and the QuickTime logo are trademarks or registered trademarks of Apple Inc., used under license therefrom. ...
-
Panasonic DMCZS8K - page 103
( for Windows® ) pour Wi ndows® © Panasonic Corporation 201 1 Super LoiloScope ( for W indows® ) pour Windows® © 2011-loilo Inc . All rights reserved /Tous droits reserves. Own er 's M a nu a l L an g u age option s Ma nue l d'ut ilis atio n Ch o ix de langue ENGLIS H FRAN<;A I S (CANADA} ESPANOL PORTUGU~S II II DMC-ZS9 C-ZS8/DMC ...
-
Panasonic DMCZS8K - page 104
UL note (DE-A65B) IMPORTANT SAFETY INSTRUCTIONS SAVE THESE INSTRUCTIONS DANGER- TO REDUCE THE RISK OF FIRE OR ELECTRIC SHOCK. CAREFULLY FOLLOW THESE INSTRUCTIONS. Use battery pack Panasonic DMW-BCG10PP (3.6V,895mAh (min.),3.3Wh) for use of Panasonic Digital Camera only. For connection to a supply not in the U.S.A., use an attachment plug adapter of ...
-
Panasonic DMCZS8K - page 105
Panasonic ideas for life Fill out and return within the next 10 days. Respond promptly and receive an "Early Bird" discount on the Panasonic Customer Care Plan! An extended service plan that assures continued top performance of your electronic product after the factory warranty has expired! www.panasonic.com/register VQC7504-1 ...
-
Panasonic DMCZS8K - page 106
Please send other correspondence to: Panasonic Customer Call Center A Unit of Panasonic Corporation of North America 661 Independence Parkway Chesapeake, VA 23320 EWS01 PANASONIC CONSUMER ELECTRONICS COMPANY PO BOX 17 4287 DENVER CO 80217-4287 I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I ...
-
Panasonic DMCZS8K - page 107
Panasonic ideas for life IMPORTANT! Please fill out and return within the next 10 days. This is your Panasonic Product Registration Card. Returning this card will not affect warranty coverage , but may expedite the processing of warranty claims. Register ONLINE at www.panasonic.com/register Regfstrese en linea en www.panasonic.com/register/spanish ...
-
Panasonic DMCZS8K - page 108
18. Which group describes your annual family income? 01. 0 Under $15,000 06. 0 $50,000-$59,999 11. 0 $150,000-$17 4,999 02. 0 $15,000-$19,999 07. 0 $60,000-$74,999 12. 0 $175,000-$199 , 999 03. 0 $20,000-$29,999 08. 0 $75,000-$99,999 13. 0 $200,000-$249,999 04. 0 $30,000-$39,999 09. 0 $100,000-$124,999 14. 0 $250,000 & over 05. 0 $40,000-$49,99 ...
A group of documents referred to as user manuals is also divided into more specific types, such as: Installation manuals Panasonic DMCZS8K, service manual, brief instructions and user manuals Panasonic DMCZS8K. Depending on your needs, you should look for the document you need. In our website you can view the most popular manual of the product Panasonic DMCZS8K.
Similar manuals
A complete manual for the device Panasonic DMCZS8K, how should it look like?
A manual, also referred to as a user manual, or simply "instructions" is a technical document designed to assist in the use Panasonic DMCZS8K by users. Manuals are usually written by a technical writer, but in a language understandable to all users of Panasonic DMCZS8K.
A complete Panasonic manual, should contain several basic components. Some of them are less important, such as: cover / title page or copyright page. However, the remaining part should provide us with information that is important from the point of view of the user.
1. Preface and tips on how to use the manual Panasonic DMCZS8K - At the beginning of each manual we should find clues about how to use the guidelines. It should include information about the location of the Contents of the Panasonic DMCZS8K, FAQ or common problems, i.e. places that are most often searched by users in each manual
2. Contents - index of all tips concerning the Panasonic DMCZS8K, that we can find in the current document
3. Tips how to use the basic functions of the device Panasonic DMCZS8K - which should help us in our first steps of using Panasonic DMCZS8K
4. Troubleshooting - systematic sequence of activities that will help us diagnose and subsequently solve the most important problems with Panasonic DMCZS8K
5. FAQ - Frequently Asked Questions
6. Contact detailsInformation about where to look for contact to the manufacturer/service of Panasonic DMCZS8K in a specific country, if it was not possible to solve the problem on our own.
Do you have a question concerning Panasonic DMCZS8K?
Use the form below
If you did not solve your problem by using a manual Panasonic DMCZS8K, ask a question using the form below. If a user had a similar problem with Panasonic DMCZS8K it is likely that he will want to share the way to solve it.