Documents that we receive from a manufacturer of a Samsung M60 can be divided into several groups. They are, among others:
- Samsung technical drawings
- M60 manuals
- Samsung product data sheets
- information booklets
- or energy labels Samsung M60
All of them are important, but the most important information from the point of view of use of the device are in the user manual Samsung M60.
- UserManuals.org
- Samsung
- Samsung Laptop
- Samsung M60
Manual Samsung M60
Go to site of 201
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
- 109
- 110
- 111
- 112
- 113
- 114
- 115
- 116
- 117
- 118
- 119
- 120
- 121
- 122
- 123
- 124
- 125
- 126
- 127
- 128
- 129
- 130
- 131
- 132
- 133
- 134
- 135
- 136
- 137
- 138
- 139
- 140
- 141
- 142
- 143
- 144
- 145
- 146
- 147
- 148
- 149
- 150
- 151
- 152
- 153
- 154
- 155
- 156
- 157
- 158
- 159
- 160
- 161
- 162
- 163
- 164
- 165
- 166
- 167
- 168
- 169
- 170
- 171
- 172
- 173
- 174
- 175
- 176
- 177
- 178
- 179
- 180
- 181
- 182
- 183
- 184
- 185
- 186
- 187
- 188
- 189
- 190
- 191
- 192
- 193
- 194
- 195
- 196
- 197
- 198
- 199
- 200
- 201
Summary
-
Samsung M60 - page 1
User Guide M60 ...
-
Samsung M60 - page 2
Chapter 1. Getting Started Product Features 2 Before Y ou Start 3 Contents 5 Safety Precautions 6 Proper Posture During Computer Use 15 Important Safety Information 18 Replacement Parts and Accessories 20 Regulatory Compliance Statements 22 WEEE SYMBOL INFORMA TION 32 Overview 33 Front View 33 Status Indicators 34 Right View 35 Left View 36 Back Vi ...
-
Samsung M60 - page 3
2 High Performance Notebook Computer A high performance computer adopting the latest CPU and DDR II memory ■ IntelCore™2DuoProcessor ,DDRIIMemory ■ WirelessLAN * ,Bluetooth * ■ 17”WideLCD ■ Blu-RayODD * Easy-to-Use A V Play A VStation * and A VStationNow * are provided to easily play ...
-
Samsung M60 - page 4
3 Before Y ou Start BeforereadingtheUserGuide,rstcheckthefollowinginformation. User Guide Information This product is supplied with an Installation Guide ,anda User Guide . Y ou can even more easily and conveniently use the computerbyusinganyoftheguidesdependingonyour needs. Insta ...
-
Samsung M60 - page 5
4 Safety Precaution Notations Icon Notation Description W arning Failing to follow instructions marked with thissymbol,maycausepersonalinjury andorfatality . Caution Failing to follow instructions marked with thissymbol,maycauseslightinjuryto yourselfordamageyourproperty . T ext Notations Ico ...
-
Samsung M60 - page 6
5 Contents Chapter 1. Getting Started Product Features 2 Before Y ou Start 3 Contents 5 Safety Precautions 6 Proper Posture During Computer Use 1 5 Important Safety Information 1 8 Replacement Parts and Accessories 2 0 Regulatory Compliance Statements 2 2 WEEE SYMBOL INFORMA TION 3 2 Overview 3 3 Front View 33 Status Indicators 34 Right View 35 Lef ...
-
Samsung M60 - page 7
6 Installation Related Power Related Do not install the product in places exposed to humidity such as a bathrooms. There is a danger of electric shock.Usetheproductwithinthe operatingconditionsspeciedin theManufacturersUserGuide. Keep the plastic bags out of the reach of children. Thereisadanger ...
-
Samsung M60 - page 8
7 If the power cord or power outlet makes a noise, disconnect the power cord from the wall outlet and contact a service center . There is a danger of electric shock orrehazard. Do not use a damaged or loose mains plug or power cord or power outlet. There is a danger of electric shock orrehazard. Plug the power cord rmly into th ...
-
Samsung M60 - page 9
8 Keep the battery out of the reach of infants and pets, as they could put the battery into their mouths. There is a danger of electric shockorchoking. Battery Usage Related If water or another substance enters the power input jack, AC adapter or the computer , disconnect the power cord and contact the service center . Damage to the device ...
-
Samsung M60 - page 10
9 Do not place any container lled with water or chemicals over or near the computer . If water or chemicals enter the computer ,thismaycausereor electricshock. If the computer is broken or dropped, disconnect the power cord and contact a service center for a safety check. Usingabrokencomputermay causeele ...
-
Samsung M60 - page 11
10 Shut down the computer and disconnect all cables before disassembling the computer . If there is a modem, disconnect the phone line. If you are using a notebook computer , make sure to remove the battery . Failingtodoso,maycause electricshock. Custody and Movement Related Follow the instructions for the relevant location (e. ...
-
Samsung M60 - page 12
1 1 Caution Failingtofollowinstructionsmarkedwiththissymbolmaycauseslightinjuryordamagetotheproduct. Installation Related Battery Usage Related Do not block the ports (holes), vents, etc. of the product and do not insert objects. Damage to a component within the computer may cause electric shockor? ...
-
Samsung M60 - page 13
12 Usage Related Do not place a candle, lighted cigar , etc. over or on the product. Thereisadangerofre. Make sure to have the product tested by a safety service engineer after repairing the product. Authorised Samsung Repair Centers will carry out safety checks afterarepair .Usingarepaired product without testin ...
-
Samsung M60 - page 14
13 Upgrade Related T ake care when touching the product or parts. Thedevicemaybedamagedor youmaybeinjured. T ake care not to throw or drop a computer part or device. Thismaycauseinjuryordamage totheproduct. Make sure to close the computer cover before connecting the power after a reassembly . There ...
-
Samsung M60 - page 15
14 Custody and Movement Related When moving the product, turn the power off and separate all connected cables rst. Theproductmightbedamagedor usersmaytripoverthecables. For long periods of not using the notebook computer , discharge the battery and preserve as it is detached. Thebatterywillbepreserved ...
-
Samsung M60 - page 16
15 Proper Posture Adjust the heights of desks and chairs appropriate to your height. Theheightsaretobeadjustedsothatyourarmformsa rightanglewhenyouplaceyourhandoverthekeyboard whilesittingdownonachair . Adjusttheheightofchairsothatyourheelis? ...
-
Samsung M60 - page 17
16 Eye Position Keep the monitor or LCD away from your eyes by at least 50cm. ■ AdjusttheheightofthemonitorandtheLCDscreenso thatitstopheightisequaltoorlowerthanyoureyes. ■ AvoidsettingthemonitorandLCDexcessivelybright. ■ Keepthemonitorand ...
-
Samsung M60 - page 18
17 V olume Control (Headphones and Speakers) Check your volume rst to listen to music. ■ Checkifthevolumeistooloudbeforeusing headphones. ■ Itisnotrecommendedusingheadphonesforlong periodsoftime. Use Time (Break T ime) ■ T akeabreakfor10minutesormorea ...
-
Samsung M60 - page 19
18 Y our system is designed and tested to meet the latest standardsforsafetyofinformationtechnologyequipment. However ,toensuresafeuseofthisproduct,itisimportant that the safety instructions marked on the product and in thedocumentationarefollowed. Caution Always follow these instructio ...
-
Samsung M60 - page 20
19 Care During Use ■ Donotwalkonthepowercordorallowanythingtorest onit. ■ Donotspillanythingonthesystem.Thebestwayto avoidspillsistonoteatordrinknearyoursystem. ■ SomeproductshaveareplaceableCMOSbatteryon the? ...
-
Samsung M60 - page 21
20 Caution Donotputrechargeablebatteriesorproducts poweredbynon-removablerechargeablebatteries inthegarbage. ContacttheSamsungHelplineforinformationonhowto disposeofbatteriesthatyoucannotuseorrechargeany longer . Follow all local regulations when disp ...
-
Samsung M60 - page 22
21 Thesocket-outletshallbeinstalledneartheequipment andshallbeeasilyaccessible. Do not unplug the power cord out by pulling the cable only . Connect and Disconnect the AC adapter Thepowercordset(wallplug,cableand ACadapterplug) you received with your computer meets the requirement ...
-
Samsung M60 - page 23
22 Regulatory Compliance Statements Wireless Guidance Lowpower ,RadioLANtypedevices(radiofrequency(RF)wirelesscommunicationdevices),operatinginthe2.4 GHzBand,maybepresent(embedded)inyournotebooksystem.Thefollowingsectionisageneraloverviewof conside ...
-
Samsung M60 - page 24
23 Caution ■ Radiofrequencywirelesscommunicationcaninterferewithequipmentoncommercialaircraft.Currentaviationregulations requirewirelessdevicestobeturnedoffwhiletravelinginanairplane. 802.1 1B(alsoknownaswirelessEthernetorWi)andBluetooth ...
-
Samsung M60 - page 25
24 USA and Canada Safety Requirements and Notices Do not touch or move antenna while the unit is transmittingorreceiving. Do not hold any component containing the radio such that theantennaisverycloseortouchinganyexposedparts ofthebody ,especiallythefaceoreyes,whiletransmitting. Do not ...
-
Samsung M60 - page 26
25 Caution Thisequipmenthasbeentestedandfoundto comply with the limits for a Class B digital device pursuanttoPart15oftheFCCRules.Theselimits aredesignedtoprovidereasonableprotection against harmful interference in a residential installation.Thisequipmentgenerateuse ...
-
Samsung M60 - page 27
26 Caution Wirelessdevicesarenotuserserviceable.Donot modifytheminanyway . Modicationtoawirelessdevicewillvoidthe authorizationtouseit.Contactmanufacturerfor service. Caution FCC Statement for Wireless LAN use: “Whileinstallingandoperatingthistra ...
-
Samsung M60 - page 28
27 Thisequipmentcannotbeusedonpubliccoinphone serviceprovidedbythetelephonecompany .Connection topartylineserviceissubjecttostatetariffs. TheT elephoneConsumerProtection Actof1991makes it unlawful for any person to use a computer or other electronicde ...
-
Samsung M60 - page 29
28 Thistransmittermustnotbecollocatedoroperatein conjunctionwithanyotherantennaortransmitterexcept theinstalledBluetoothtransmitter . Operationofthisdeviceissubjecttothefollowingtwo conditions:(1)Thisdevicemaynotcauseharmful interferenc ...
-
Samsung M60 - page 30
29 European Union CE Marking and Compliance Notices Products intended for sale within the European Union are markedwiththeConformitéEuropéene(CE)Marking, whichindicatescompliancewiththeapplicableDirectives andEuropeanstandardsandamendmentsidentied below .Thisequipmentalsoc ...
-
Samsung M60 - page 31
30 T ranslated Statements of Compliance [English] This product follows the provisions of the European Direc - tive1999/5/EC. [Danish] Dette produkt er i overensstemmelse med det europæiske direktiv1999/5/EC [Dutch] DitproductisinnavolgingvandebepalingenvanEurop- eesDirectief1999/5/EC. [Finnish] Tämätuote ...
-
Samsung M60 - page 32
31 General Europeanstandardsdictatemaximumradiatedtrans - mitpowerof100mWeffectiveisotropicradiatedpower (EIRP)andthefrequencyrange2400–2483.5MHz. Belgium Theproductmaybeusedoutdoors,butforoutdoortrans - missionsoveradistanceof300morm ...
-
Samsung M60 - page 33
32 WEEE SYMBOL INFORMA TION Correct Disposal of This Product (W aste Electrical & Electronic Equipment) (Applicable in the European Union and other European countries with separate collection systems) Thismarkingshownontheproductoritsliterature,indicatesthatitshouldnotbedisposedwithotherhous ...
-
Samsung M60 - page 34
33 Overview Before Y ou Start! ■ * Theitemsmarkedwiththissymbolareoptionalitemswhichmaybechangedormaynotbeprovideddependingonthe computermodel. ■ Theactualcolorandappearanceofthecomputermaydifferfromthepicturesusedinthisguide. ...
-
Samsung M60 - page 35
34 7 Charge Status Thisshowsthepowersourceandthebatterychargestatus. Blue: Whenthebatteryisfullychargedorthebatteryisnotinstalled. Amber: Whenthebatteryisbeingcharged. Off: Whenthecomputerisrunningonbatterypowerwithoutbeing connected ...
-
Samsung M60 - page 36
35 4 Caps Lock This turns on when the Caps Lock key is pressedallowingcapitalletterstobetyped withoutholdingtheShiftbuttondown. Right V iew 1 CD Drive (ODD) * PlaysCDorDVDtitles. SinceanODDdriveisoptional,theinstalleddrivedepends onthecomputermodel. p.50 ...
-
Samsung M60 - page 37
36 Left V iew 2 Fan V ents The internal heat of the computer is emitted through theseholes. Caution Iftheventsareblockedthecomputermay overheat. Avoidblockingtheventsasthismay bedangerous. 4 Wired LAN Port ConnecttheEthernetcabletothisport. p.95 5 Modem Port * A por ...
-
Samsung M60 - page 38
37 1 Security Lock Port Y oucanconnectaKensingtonlocktotheSecurityLock Porttopreventthecomputerfrombeingstolen. Back V iew 2 Battery ThisisaLithium-Ionrechargeablebatterythat suppliespowertothecomputer . p.142 5 DC Jack A jacktoconnectthe AC? ...
-
Samsung M60 - page 39
38 Bottom V iew 1 Battery Latches Thelatchusedtoremoveorinstallthebattery . p.142 3 Memory Compartment Cover Themainmemoryisinstalledinsidethecover . p.140 2 Hard Disk Drive Compartment Cover Theharddiskdriveisinstalledinsidethecover . Caution Y ouwillbe ...
-
Samsung M60 - page 40
39 T urning the Computer On and Off T urning the computer on 1 Install the battery and connect the AC adapter . (Refer to the Installation Guide .). 2 Slide the LCD Latch to the right and then lift up the LCDpanel. 3 Press the Power button toturnthecomputeron. Note ■ IfyoupressandreleasethePowerbutton? ...
-
Samsung M60 - page 41
Chapter 2. Using the computer Keyboard 41 T ouchpad 44 Using the Remote Control (Optional) 47 CD Drive 50 InsertingandEjectingaCD 5 0 Burning a CD 5 1 HDDVD(Optional) 5 2 Blu-Ray(Optional) 5 4 Multi Card Slot 56 PC Card Slot 59 Connecting a monitor / TV 60 ConnectingaMonitor 6 0 Connecting a TV 6 1 Viewing ...
-
Samsung M60 - page 42
41 Keyboard Note Thekeyboardissuppliedaccordingtothecorrespondingcountry .Refertothekeyboardgureforthecorrespondingcountry . United Kingdom United States ...
-
Samsung M60 - page 43
42 Shortcut Keys Y oucanusethefollowingfunctionsbypressingthekeysbelowwiththe Fn key . Fn+ Name Function REST (Sleep Mode) SwitchestoSleepmode. T owakethecomputerup,pressthePowerbutton. Gauge Showstheremainingbatterycharge. Y oucanonlyusethisfun ...
-
Samsung M60 - page 44
43 Screen Brightness Control T oadjusttheLCDbrightnesspressthe Fn + ( )key combinationorthe Fn + ( )keycombination. The changedscreenbrightnessisdisplayedatthecenterof thescreenforamoment. V olume Control T ocontrolthevolume,pressthe Fn + ( ) ...
-
Samsung M60 - page 45
44 T ouchpad Thetouchpadprovidesthesamefunctionasamouseandtheleftandrightbuttonsofthetouchpadplaystheroleof theleftandrightbuttonsofamouse. Before Y ou Start! ■ UsetheT ouchpadwithyourngers.Usingasharpobjectmaydamagethe ...
-
Samsung M60 - page 46
45 Moving the cursor on the screen Placeyourngeronthetouchpadslightlyandmoveyour nger .Themousecursorwillmoveaccordingly .Move yourngerinthedirectionyouwishtomovethecursor . Click Function Placeyourngeronthetouchpadandtapyour? ...
-
Samsung M60 - page 47
46 Drag Function Dragging refers to moving an item to another place after selectingit. Pressandholddownthelefttouchpadbuttonoveran item you want to drag and move the item to the new location. T ouchpad Scroll Function The touchpad scroll area provides the mouse wheel function(scrollfunction). Placeyour? ...
-
Samsung M60 - page 48
47 Using the Remote Control (Optional) Usingtheremotecontrolforthecomputerisdescribedbelow .T ousetheremotecontrol,installthesuppliedbattery intotheremotecontrolrst. Installing Battery 1 Movethegroove(◄)onthecovertothe(●)position byusing ...
-
Samsung M60 - page 49
48 Remote Control Buttons 1 Power / Sleep Button Press to turn the computer on ortoenterSleepmode. 3 BACK Button * Press to return to the previous step. 4 Direction Button * Presstomovetoanitem. 5 These buttons are not use. 2 Playback Control Button 8 ENTER Button Presstoexecutetheselecteditem. 9 V olume Co ...
-
Samsung M60 - page 50
49 Remote Control Operating Range Thevaliddistancefortheremotecontrolisdeterminedbytheuserenvironment.Itisrecommendedtousetheremote controlwithin3metersanda45degreeanglefromtheremotecontrolsensoronthedevice. Safekeeping Y our Remote Control When ...
-
Samsung M60 - page 51
50 CD Drive Anopticaldiskdriveisoptionalandmaydifferdependingonyourcomputermodel.Fordetailedspecications,refer tothecatalog. Before Y ou Start! Oneofthefollowingopticaldiskdrivesisinstalledonthiscomputer . Drive T ype Function DVD-ROM ReadsCD/DVD. RW ...
-
Samsung M60 - page 52
51 IfyourcomputerhasawritableCDdrive,youcanwrite dataontoaCDorDVDorburnanaudioCD. CyberLink DVD Suite is supplied with the System Software Media (oranadditionalCD)sothatyoucan burnaCDusingtheprogram. Install the provided software and use the sof ...
-
Samsung M60 - page 53
52 HD-DVDisanextgenerationstoragemediathatcansavemoredatathantheexistingDVDformat. Y oucanrecordandplaybetterqualityHDmoviesthantheexistingSD-gradeDVDformat. T ype HD DVD DVD CD Logo Storage Capacity 15GB/30GB 4.7GB/8.5GB 0.65GB Data ...
-
Samsung M60 - page 54
53 About HD DVD TheCyberLinkHDDVDSolutionprogramisprovided sothatuserswithHD-DVDDrivescanconvenientlyand easilyrecord multimedialesandot herdataontoHDDVD disks. Note Foramoredetaileddescriptionofthefunctions,referto thehelpsection ...
-
Samsung M60 - page 55
54 Blu-Rayisanextgenerationstoragemediathatcansaveapproximately5to10timesmoredatathantheexistingDVD format.Y oucanrecordandplaybetterqualityHDmoviesthantheexistingSD-gradeDVDformat. T ype Blu-Ray DVD CD Logo Storage Capacity 25GB/50G ...
-
Samsung M60 - page 56
55 About Blu-Ray TheCyberLinkBDSolution(hereafterCBDS)program isprovidedsothatuserswithBlu-RayDrivescan convenientlyandeasilyrecordmultimedialesandother dataontoBlu-Raydisks. Note Foramoredetaileddescriptionofthefunctions,referto thehel ...
-
Samsung M60 - page 57
56 Multi Card Slot Usingthemulticardslot,youcanreadandwritedatatoaMemoryStick,MemoryStickPro,SDcard,MMC,MMC Plus,andxDcard. Y oucanuseacardasaremovablediskandconvenientlyexchangedatawithdigitaldevicessuchasadigital ...
-
Samsung M60 - page 58
57 T o Insert and Use a Memory Card 1 Insert a card into the slot according to the directions printedontheslot. 2 Thecarddriveappears.Click Open folder and view les .Ifthewindowdoesnotappear ,click Start > Computer . Note Ifawindowaskingtoscanandchangeappears, clic ...
-
Samsung M60 - page 59
58 T o remove a memory card 1 Pushthetipofthecardlightly . 2 Ifthecardpopsupwithaclickingsound,removethe card. T o format a memory card Y ouhavetoformatacardrsttouseit. Caution Formatting a card deletes all data saved on the card.Ifthecardincludes? ...
-
Samsung M60 - page 60
59 T o insert a PC card 1 Insert a PC card into the PC card slot on the side of thecomputer . 2 Ifyouinsertacardintotheslot,Windowsrecognizes the card automatically or a message telling youtoinstalladriverappears.Ifthecardisnot automaticallyrecognized,installthedevice ...
-
Samsung M60 - page 61
60 Connecting a monitor / TV Usinganexternaldisplaydeviceisusefulwhenyouaregivingapresentationorwatchingavideoormoviethrough yourmonitor . Before Y ou Start! Y ouhavetobuyaconnectioncableadditionally . Connecting to the Monitor port Connectthemonitortothe? ...
-
Samsung M60 - page 62
61 SincetheporttoconnecttoaTVdif fersdependingontheporttypeusedtoconnecttheTV ,connectasfollows. Connecting to the Monitor port ConnectthemonitorandcomputerusingthePCInput(RGB)portontheTVwiththemonitorcable(15pin). Connecting a TV Co ...
-
Samsung M60 - page 63
62 V iewing Through a Monitor / TV Y oucanswitchthedisplaydeviceusingtheshortcutkey . Switching the Display Device using the Shortcut Key Press the Fn + ( )keycombinationonce.Thenthe Easy Display Manager screen appears in which you can selectadisplaydevice. Wheneveryoupressthe( )k ...
-
Samsung M60 - page 64
63 What is DVB-T (Digital Video Broadcasting-T errestrial)? DVB-TisaEuropeanterrestrialdigital TVstandardthat provides higher quality audio and video than conventional analogTV . Connecting and Setting up the Antenna 1 ConnecttheTVdonglecabletothe TV Antennajack ofthecomputera ...
-
Samsung M60 - page 65
64 Adjusting the V olume using the Keyboard Press the Fn + ( )keycombinationor Fn + ( )key combinationtoadjustthevolume. Press the Fn + ( )keycombinationtoturnthevolume onoroff. Adjusting the V olume using the V olume Adjustment Program Click the V olume icon ( )onthetaskbarand ...
-
Samsung M60 - page 66
65 Using SRS TheSRSfunctionenablesyoutoexperiencemore stereophonicsoundusingstereospeakers. 1 Right-clickoverthe V olume icon ( )intheT askbar and select Play Device (P) . 2 Select Speaker inthePlaytabandclick Properties . 3 Select the SRS tabinthe Speaker Pr ...
-
Samsung M60 - page 67
66 Using Digital Output (S/PDIF) Y oucanenjoy5.1channelsurroundsoundbyusingtheHeadphone/S/PDIFjack. Before Y ou Start! T o listen to 5.1 channel surround sound, follow the procedures below. ■ Connecttoa5.1channelspeakersystemusingtheHeadphone/S/PDIFjack. ■ SelectDigital? ...
-
Samsung M60 - page 68
67 Connecting 5.1 Channel Speakers 1 ConnecttheS/PDIFcabletotheS/PDIFjackandconnecttheotherendofthecabletothe5.1channelspeaker system. Note ■ Sincetheprocedurestoconnecta5.1channelspeakersystemmaydifferdependingonthesystemmodel,? ...
-
Samsung M60 - page 69
68 Selecting Digital Output in the DVD Player Program SincethesoundsettingissettoDigitalOutputbydefault,youdonotadditionallyneedtocongureitfordigitaloutput. Y oucanconrmyoursettingsasfollows. 1 IftheCyberLinkPowerDVDprogramisnotinstall ...
-
Samsung M60 - page 70
Chapter 3. The screen shots used in this chapter may differ from actual screens depending on the Windows V ista version and model. Using Microsoft W indows V ista About Microsoft Windows V ista 70 WelcomeCenter 7 0 HelpandSupport 71 Windows V ista Screen Layout 72 Desktop 72 StartMenu 7 4 Sidebar/Gadget 7 6 Window 7 ...
-
Samsung M60 - page 71
70 IntheWelcomeCenter ,youcanviewbriefdescriptionsofWindowsVistafunctionsandrunthefunctionsdirectly . 1 Click Start ( ) > W elcome Center . 2 Ifyouclickonanitem,informationonthefunctionisdisplayedinthedescriptionwindow . Forexample,ifyou? ...
-
Samsung M60 - page 72
71 Help and Support WindowsHelpandSupportprovidesinformationonWindowsbasicfunctionsandusages. Click Start ( ) > Help and Support . Y oucanndhelpforfrequentlyusedbasicfunctionsusingFindan Answerandyoucansearchforhelpbyenteringa keywordinthe ...
-
Samsung M60 - page 73
72 Windows V ista Screen Layout Desktop Ifyouturnthecomputeron,theDesktopscreenappears. Thedesktopistheworkingareaonthecomputer .Itconsistsofalargeworkspaceandataskbaratthebottomasshown inthegurebelow . Note Thescreenlayoutmaydiff ...
-
Samsung M60 - page 74
73 1 Recycle Bin Y oucandropuselesslesandfoldershere. 2 Shortcut Icons Y oucanlaunchprogramsbyclickingtheshortcuticonsontheDesktop. 3 Start Menu Themenufromwhichyoucanlaunchprograms. 4 Start Button Pressthestartbutton.TheStartmenuappears. 5 T askbar C ...
-
Samsung M60 - page 75
74 Start Menu Themenufromwhichyoucanlaunchprograms. Click Start ( ).TheStartmenuappears. Alternatively ,presstheWindowskey( )onthekeyboard. Fixed Programs The program or search result is displayed. All Programs Y ou can search for les, folders, etc. Username Search Computer Control Panel H ...
-
Samsung M60 - page 76
75 Search Enablesuserstosearchforlesandfolders. Computer Showsstoragedevicessuchasharddiskdrives,CD/DVDdrives,networkdrives,etc. Inaddition,youcanmanagelesandfoldershere. Control Panel EnablesuserstoconguretheappearanceandsettingsofW ...
-
Samsung M60 - page 77
76 Sidebar / Gadget SidebarisaverticalbarthatappearsatthesideoftheDesktop. A miniprogramcalledGadgetrunsovertheSidebarwhichshowsinformationsuchasstocks,schedule,weather ,etc.and providesfrequentlyusedtools. Y oucandownloadvariousGadgets ...
-
Samsung M60 - page 78
77 Adding a Gadget Y oucanndagadgetinthe Gadget Gallery andaddittotheSidebar . 1 If you click the + atthetopoftheSidebar ,theGadgetGalleryopens. 2 Ifyoudouble-clickonagadget,thegadgetisaddedtotheSidebar . Note ■ Y oucanmovea ...
-
Samsung M60 - page 79
78 Exiting the Sidebar Right-clickontheSidebaricon( )intheSystemT raywiththeclockonthetaskbarandselect Exit toexittheSidebar . Note Closing the Sidebar ■ EvenifyouclosetheSidebar ,theSidebarcontinuesrunningintheSystemT rayintheclock? ...
-
Samsung M60 - page 80
79 Window A windowisthebasicframeforacomputeroperation. Asanexample,let’sseethelayoutofa Pictures Window . Click Start ( ) > Pictures. Note TheitemsandnamesmaydifferdependingonyourcomputermodelandtheWindowsV istaversion. Window Layout 1 Addres ...
-
Samsung M60 - page 81
80 1 Address Display Line Showsthelocationofthecurrentlyselectedfolderorle. 2 Move Button Y oucanmovetothepreviousornextpagebyclickingtheBackorNextbuttons. Opensthepreviouslyopenedpage. Opensthenextpage,whenyouhavereturnedtoapr ...
-
Samsung M60 - page 82
Window V iew Functions Note Ifyouhavesetupthe Aerofunction,youcanuse thewindowviewfunctions. Ifyouwanttousethe Aerofunction,click Start > Control Panel > Appearance and Personalization > Window Color and Appearance .SelectWindow Aerofromthecolor schem ...
-
Samsung M60 - page 83
Control Panel T oolsforconguringWindowsarelocatedintheControlPanel. Opening the Control Panel Click Start ( ) > Control Panel . System and Maintenance Usingthisfunction,youcancongureWindowsperformanceoptions. Security Usingthisfunction,youcancheckthecurrentsecurity? ...
-
Samsung M60 - page 84
User Accounts and Family Safety Y oucanchangetheuseraccountsettings,passwordsandconguretheParental Controlsfunction. Appearance and Personalize Usingthisfunction,youcanconguretheDesktopstyle,themeorscreensaver settings. Clock, Language, and Region Usingthisfun ...
-
Samsung M60 - page 85
User Accounts UsingWindowsVistaUser Accounts,morethanoneusercaneasilysharethesamePC. Theprocedurestoaddanddeleteauseraccountandtoswitchusersaredescribedbelow . Adding User Accounts 1 Click Start ( ) > Control Panel> User Accounts and Family Safety . 2 Click ...
-
Samsung M60 - page 86
Removing User Accounts Note ■ If there is only one administrator account for the computer ,youcannotdeletethe administrator account . ■ Y ou can only delete another account when you areloggedinasanadministrator . 1 Click Start ( ) > Control Panel > User Accounts and Family Safety > User Accounts . 2 ...
-
Samsung M60 - page 87
Changing the screen resolution and the color Theresolutionreferstothenumberofpixelsdisplayedonthescreen.Whenincreasingtheresolution,theitemsonthe Desktopbecomesmallerandmoreitemscanbedisplayedonthescreen.Thehigherthecolorquality ,themor ...
-
Samsung M60 - page 88
Conguring the Start Menu Power Button ThePowerbuttonontheStartmenu( )performs variousoperationsdependingonthesettings. 1 Click Start ( ) > Control Panel > Hardware and Sound > Power Options and then Change Battery Settings . 2 Click on Change Plan Settings in the currently selectedpowerset ...
-
Samsung M60 - page 89
4 Select a power plan and click the OK button. T ype Description Power Button Image after Setting Change Sleep SetsthecomputertoenterSleepmode. Thescreenandharddiskwillbeturnedofftoreducethepowerconsumptionof theoverallsystem. IfyoupressthePowerbuttononthe? ...
-
Samsung M60 - page 90
Phishing Filter Settings 1 LaunchInternetExplorer . 2 Select T ools from the menu and click Phishing Filter > Phishing Filter Settings . Phishing Filter Phishingisamethodusedbyhackerstoillegallycollectpersonalinformationsuchascreditcardnumbers,passwords, otheraccountnumbers,etc ...
-
Samsung M60 - page 91
90 3 TheInternetOptionswindowopens. LocatethePhishingFilteritemintheSettingseld.Select T urn on automatic website checking and click the OK buttontousethePhishingFilter . 4 T onotusethePhishingFilter ,select T urn off automatic website checking intheSe ...
-
Samsung M60 - page 92
User control function Usingthisfunction,youcancontrolthecontentyourchildrencanaccess.Y oucandetermineforhowlongtheycanuse thecomputerandthecontenttheycanaccess.Whenyouhavenishedthesettings,clickOKtonish. Conguring Parental Cont ...
-
Samsung M60 - page 93
Using Activity Report Y oucanviewandevaluateyourchildren’sinternetaccess throughthe ActivityReport. 1 Openthe User Controls window referring to the descriptions of Parental Controls . 2 Set Activity Reporting to On . 3 T oviewthe ActivityReport,clickon View Activity Report on ...
-
Samsung M60 - page 94
UsingWindowsMobileCenter ,youcaneasilycongurecomputersettingssuchasthevolume,thewirelessnetwork connectionsettings,thedisplaysettings,etc.allatthesametime. Note SomefunctionsmaynotbesupporteddependingontheWindowsVistaversion. 1 Click ...
-
Samsung M60 - page 95
Chapter 4. Using the Network Wired Network 95 Wireless Network 98 ConnectingtoaWirelessLAN 9 9 Using the Easy Network Manager 100 NetworkSettings 10 0 Usingin AnotherLocation 10 2 DiagnosingtheNetworkStatus 10 3 Connecting with a Modem 104 Bluetooth 105 BluetoothFunction 10 5 UsingBluetooth 1 ...
-
Samsung M60 - page 96
95 1 ConnectaLANcabletothecomputer ’sLANport. 2 Click Start > Control Panel > Network and Internet > Network and Sharing Center . 3 Click Manage Network Connections from the left pane. 4 Right-clickoverthe Local Area Connection and select Properties . Wired Network A wirednetworkisa ...
-
Samsung M60 - page 97
96 5 Select Internet Protocol V ersion 4 (TCP/IPv4) from the Networking tabandclick Properties . Note ■ TheLANdevicedrivermaydifferdependingon yourLANdevicemodel. ■ T oaddanetworkcomponent,click Install in the screenshowninthegureabove.Y oucanadd ...
-
Samsung M60 - page 98
97 Using both DHCP and a xed IP simultaneously Using the Alternate Conguration providingbyWindows Vista,youcansetbothautomaticandxedIP addresses and then you can select to use either of them to connect totheInternet. 1 Click Start > Control Panel > Network and Internet > Network and ...
-
Samsung M60 - page 99
98 Wireless Network A wirelessnetwork(WirelessLAN)environmentisanetworkenvironmentthatenablescommunicatingbetween multiplecomputersathomeorasmall-sizeofcethroughwirelessLANdevices. Before Y ou Start! ■ Thedescriptionsbelowareforcomputermodelswith ...
-
Samsung M60 - page 100
99 Connecting to a Wireless LAN Ifthereisan AP ,youcanconnecttotheInternetviathe APusingtheWirelessLANconnectionmethodprovided byWindowsVista. 1 Right-clickoverthe Network Connections ( )icon onthetaskbarandclick Connect to the Network . 2 Select ...
-
Samsung M60 - page 101
100 Using the Easy Network Manager EasyNetworkManagerisaprogramthathelpscongurethenetworksettings. EasyNetworkManagerprovidesthefollowingfeatures. Y ou can easily congure the network and printer settings. p.100~101 Y ou can immediately use the network without having to dene n ...
-
Samsung M60 - page 102
101 5 Select Internet Direct Connection and click the Next button. 6 SelecttheLANdevice,setuptheIPaddressand click the Next button. 7 Click Add Printer and set up a printer according to thewizard.Whentheprinterhasbeenadded,click the Refresh button,selectthenewlyaddedp ...
-
Samsung M60 - page 103
102 Using in Another Location Byconguringthenetworksettings(IPaddress,printer setting,etc.)foreachlocation,youcanimmediately accessthenetworkinoneclick,withoutperformingthe networksettingproceduresregardlessofyourlocation. 1 Click Start > All Programs ...
-
Samsung M60 - page 104
103 Diagnosing the Network Status Y oucandiagnosethenetworkstateandndsolutionsfor whyyoucannotconnecttothenetwork. 1 LaunchEasyNetworkManager . 2 Select Management > Diagnose Status from the menu. 3 TheNetworkConnectionswindowappears. Click Start tostartt ...
-
Samsung M60 - page 105
104 1 ConnectthephonecabletotheModemport. T akecaretonotconnectadigitalphonelinetothemodemport. 2 ConnecttotheInternetaccordingtotheinstructionsofyourInternetserviceprovider(ISP). Note IftheInternetconnectionisterminatedabnor ...
-
Samsung M60 - page 106
105 File T ransmission Y oucanexchangelesbetweentwoBluetoothdevices. Y oucanexchangeleswithanotherBluetoothdevicesuchasanothercomputer ,cell phone,PDA,etc. Network Access Y oucanconnecttoanotherBluetooth-installedcomputerinthesamewayasan A ...
-
Samsung M60 - page 107
106 Using Bluetooth Theprocedurestoexchangelesbetweencomputers supporting Bluetooth and to use other Bluetooth devices aredescribedbelow . Using Bluetooth Devices (Connecting Headset supporting Bluetooth) Asanexample,theprocedurestoconnecttoaheadset supportingBluetoothwillbedes ...
-
Samsung M60 - page 108
107 5 EnterthePINinthedevicePINeldandclickthe Next button. Note Forpairing,aPINisrequired.SinceaPINis providedbytheheadsetmanufacturer ,refertothe correspondingmanual. 6 IftheCompletingthe AddBluetoothDeviceWizard window? ...
-
Samsung M60 - page 109
108 3 SelectaBluetoothdevicetosendthelefromand click the OK button. 4 EnteraPINintheBluetoothPINCodeeldandclick the Next button. Note The Bluetooth PIN Code is a password used for connectingtwoBluetoothdevices.Theuserjust entersthesamePI ...
-
Samsung M60 - page 110
Chapter 5. Using Applications Introducing Programs 1 10 CyberLink PowerDVD (Optional) 1 13 Samsung Update Plus (Optional) 1 15 Play A VStation (Optional) 1 17 LaunchingandScreenLayouts 1 1 7 MovieStation 1 1 8 MusicStation 12 2 PhotoStation 12 6 A VStation Now (Optional) 130 Start 13 0 Exit 13 0 ScreenLayou ...
-
Samsung M60 - page 111
1 10 Introducing Programs UsingthesoftwaresuppliedwiththeSamsungcomputer ,youcaneasilyusefunctionsandtroubleshootproblems. T rytousethesoftwareafterlearningaboutthebasicuseofthesoftware.Fordetailedinformation,refertothehelp sectionofthe ...
-
Samsung M60 - page 112
1 1 1 Multi Media Functions CyberLink PowerDVD ( ) (Optional) T ousethisprogram,youhavetoinstalltheprogram manually using the additionally supplied System SoftwareMedia(orotherCD). p.1 13 Play A VStation ( ) (Optional) Play A VStation is an integrated multimedia program thatenablesuse ...
-
Samsung M60 - page 113
1 12 T roubleshooting Functions SAMSUNG Magic Doctor ( ) (Optional) SAMSUNGMagicDoctoristroubleshootingsoftware providedbySamsungComputerforsystemdiagnosis, andrestoringthesystem. Thesystemdiagnosisfunctionenablesusersto diagnosesystemproblemswithoutassistancefr ...
-
Samsung M60 - page 114
1 13 1 InsertaDVDtitleintotheDVDdrive. 2 Select PowerDVD and click the OK button. Afteramoment,theDVDtitlewillplay . 3 IftheDVDtitleisnotautomaticallyplayed,click Start > All Programs > CyberLink DVD Suite > Power DVD > CyberLink PowerDVD . 4 Then click the ...
-
Samsung M60 - page 115
1 14 Note ■ Detailed Usage Formoredetailedusage,click Start > All Programs > Cyberlink DVD Suite > Power DVD > PowerDVD Help . ■ DVD Region Code A DVDtitlehasaregioncodeaccordingtotheinternationalspecicationssothatitcanbeplayedonlyinthatspecic? ...
-
Samsung M60 - page 116
1 15 Samsung Update Plus (Optional) SamsungUpdatePlusissoftwarethatexaminesandupdatestheSamsungsoftwareanddriversinstalledonyour Samsungcomputertothelatestversion. Before Y ou Start! ■ T osearchforupdatesandupdateyourcomputerusingSamsungUpdatePlu ...
-
Samsung M60 - page 117
1 16 3 Ifthereareavailablesoftwareordriverupdatesfor yourcomputer ,theavailableupdateswillbelisted. Select the required updates from the list and click on Install Updates tostarttheupdate. Caution Updates that must be installed separately . If you select Install foranupdate ...
-
Samsung M60 - page 118
1 17 T olaunchtheprogram,click Start > All Programs > Samsung > Play A VStation . Alternatively ,double-clickthePlay A VStationicon( )ontheDesktop. Movie Y oucanplayavideo(movie)le. Music Y oucanplayamusicleoranaudioCD. Photo Y oucanvieworedit? ...
-
Samsung M60 - page 119
1 18 Note ● What is EDI (Enhanced Digital Image)? EDI(EnhancedDigitalImage)isvisualqualityenhancementtechnologydevelopedbySamsungElectronics.Y oucanview clearerandsharperimagesbyenablingtheEDIfunctionwhenwatchingTVorplayingamovieonPlay A VStation ...
-
Samsung M60 - page 120
1 19 Playing a Movie File TheprocedurestoplayamovieleregisteredtotheMOVIELibraryaredescribedbelow .Fortheprocedurestoregister lestotheLibrary ,referto p.120. 1 Moveto Movie Station anddouble-click All Video intheleftmenupane. ...
-
Samsung M60 - page 121
120 Adding Videos to the Library TheMovieLibraryisalibrarywithmovielestobeused byMovieStation.Theprocedurestoaddmovieles savedonthecomputertotheLibraryaredescribedbelow . Y oucanaddlesorfolders. Asanexample,the procedures ...
-
Samsung M60 - page 122
121 Highlight / Chapter Function UsingtheHighlightfunction,youcanwatchahighlighted partofamoviesuchasasportsornewsitem,etc.Using theChapterfunction,youcancreatechaptersforamovie andplaythemoviefromanyofthechapters. Note TheHigh ...
-
Samsung M60 - page 123
122 Music Station Launch Play A VStation and click Music ontheStationBar . Playlist Window Music Search V olume Control Music Library Music T ype Repeat Setting Random Play Setting EQ EDS Play Control Buttons ...
-
Samsung M60 - page 124
123 Playing an Audio CD TheprocedurestoplayanaudioCDaredescribedbelow . 1 InsertanaudioCDintotheCDdrive. 2 Ifthe AutoPlaywindowappears,select Play audio CD using Samsung PLA Y A VStation . 3 TheCDisplayed. Note IfaCDisalreadyinsertedintheC ...
-
Samsung M60 - page 125
124 Playing a Music File IfamusicleisregisteredtotheMusicLibrary ,youcaneasilyplaythemusicle.Fortheprocedurestoregistertracksto theLibrary ,referto p.125. 1 Moveto Music Station anddouble-clickon All Music . 2 Double-clicka? ...
-
Samsung M60 - page 126
125 Adding Music Files to the Library TheMusicLibraryisalibrarywithmusiclesusedby MusicStation.Theprocedurestoaddmusiclessaved onthecomputertotheLibraryaredescribedbelow . Y oucanaddles,folders. Asanexample,theprocedurestoad ...
-
Samsung M60 - page 127
126 Launch Play A VStation and click on Photo ontheStationBar . Photo Station Photo Library Photo List and Thumbnail Window Batch Edit Button SlideShow Button View and Edit Button ...
-
Samsung M60 - page 128
127 Viewing an Image The procedures to view images registered to the Photo LibraryindividuallyandviaaSlideShowaredescribed below . FortheprocedurestoregisterimagelestotheLibrary , refer to p.129. 1 Moveto Photo Station anddouble-clickon All Images . 2 Double-cl ...
-
Samsung M60 - page 129
128 Editing an Image Y oucanchangetheshapeofanimage,editanimage orapplyspecialeffectstoanimage. Theimageediting functionsaredescribedbelow . 1 Moveto Photo Station anddouble-clickon All Images . 2 Clickonafolderwhichincludesimages, ...
-
Samsung M60 - page 130
129 Adding Images to the Library ThePhotoLibraryisalibrarywithimagelestobeusedbyPhotoStation.Theprocedurestoaddimagelessavedon thecomputertotheLibraryaredescribedbelow . Y oucanaddles,addfolders. Asanexample,theprocedures ...
-
Samsung M60 - page 131
130 A VStation Now (Optional) Using A VStationNow ,youcaneasilyandquicklyplaymusic,photographs,movieswhenthecomputerison/off. Start Regardlessofwhetherthecomputerisonoroff,youcan launch A VStationNow( )bypressingeitherthe A VNow buttonorth ...
-
Samsung M60 - page 132
Chapter 6. Settings and Upgrade LCD Brightness Control 132 BIOS Setup 133 EnteringtheBIOSSetup 13 3 TheBIOSSetupScreen 13 5 Setting a Boot Password 137 Changing the Boot Priority 139 Upgrading Memory 140 Battery 142 Installing/RemovingtheBattery 14 2 ChargingtheBattery 14 3 MeasuringtheRemainingBat ...
-
Samsung M60 - page 133
132 Controlling the Brightness Using the Keyboard AdjusttheLCDbrightnessbypressingthe Fn + ( )keyorthe Fn + ( )key . TheLCDbrightnesscanchangeupto8levelsandthebrightnessincreasesby1levelwhenpressingthe Fn + ( )key once. Note ■ Maintaining the ...
-
Samsung M60 - page 134
133 1 T urnthecomputeron. 2 Whenthebootingscreen(SAMSUNGlogo)appears,presstheF2keytoentertheBIOSSetup. Entering the BIOS Setup BIOS Setup TheBIOSSetupenablesyoutocongureyourcomputerhardwareaccordingtoyourneeds. Before Y ou Start! ■ Usethe ...
-
Samsung M60 - page 135
134 3 Afteramoment,theBIOSsetupscreenappears. TheitemsintheBIOSsetupmaydifferdependingontheproduct. Setup Menu Setup Items Help Helpfortheselecteditem appearsautomatically . ...
-
Samsung M60 - page 136
135 The BIOS Setup Screen Menu Description Main Usedtochangethebasicsystemandenvironmentsettings. Advanced Usedtocongureadvancedfunctionsonyourcomputerarounddevicesandchipsets. Security Usedtoconguresecurityfunctions,includingpasswords. Boot Usedtosettheboo ...
-
Samsung M60 - page 137
136 System Setup Keys IntheSetup,youhavetousethekeyboard. F1 PresstoviewtheSetupHelp. Up & Down Keys Presstomoveupanddown. F5/F6 Presstochangetheitemvalue. F9 PresstoloadthedefaultSetupsettings. ESC Presstoreturntoahigherlevelmenuor ...
-
Samsung M60 - page 138
137 Setting a Supervisor Password A Supervisor Password is required to turn the computer onortostarttheSystemSetup. WhensettingaSupervisorPassword,usersotherthana supervisorcannotusethecomputer . 1 Select the Security menuintheBIOSSetup. 2 In the Set Supervisor Password item ...
-
Samsung M60 - page 139
138 Setting a User Password Userscanstartthesystemwithauserpassword,but cannotentertheSystemSetup.Bydoingthis,youcan preventotherusersfromenteringSetup. Beforeconguringauserpassword,asupervisor passwordmusthavebeencongured.Deactivati ...
-
Samsung M60 - page 140
Select system boot options Boot Device Priority NumLock [Off] Enable Keypad [By NumLock] Summary screen [Disabled] Boor-time Diagnostic Screen [Disabled] PXE OPROM [Only with F12] Brightness Mode Control [Auto] Smart Battery Calibration Boot Device Priority Boot priority order: ▼ IDE CD : Slimtype COMBO SSC-2485K ▼ IDE HDD : SAMSUNG xxxxxxx ▼ ...
-
Samsung M60 - page 141
Fixing Screw 140 Upgrading Memory Oneormorememorymodulesareinstalledonthecomputer . Thereare2memoryslots.Oneisinsidethemainboardandtheotherisatthebottomofthecomputer . Y oucanonlyaddorreplacememorytoandfromthememoryslotat ...
-
Samsung M60 - page 142
141 3 Push the memory module down so that it is completelyxed.Ifthememorydoesnotteasily , push the memory module down while pulling the memorymodulelatchesoutward. 4 Close the memory compartment cover and fasten thescrew . Note Removing a memory module Pullthememorymodulelatchesoutward. ...
-
Samsung M60 - page 143
142 1 Shutdownthesystem,closetheLCDpaneland placethecomputerupsidedownonaatsurface. 2 Pullthetwobatterylatchesoutwards( ),then removethebattery . 3 T oinstallthebatteryagain,slidethebatteryintothe system. Thebatterylat ...
-
Samsung M60 - page 144
143 T o view on the battery Separatethebatteryandpressthe PUSH buttoninside thebattery .Theremainingbatterycharge(%)willbe displayed. Note Battery W arning ■ Y ou will hear an alarm when the remaining batterychargereachesbelow10%. Inthiscase,connectthe ACadapte ...
-
Samsung M60 - page 145
Extending the Battery Usage T ime 144 Decreasing the LCD Brightness Press the Fn + ( )keysonthekeyboardtodecreasetheLCDbrightnesstoextendthebatteryusagetime. Using Easy Battery Manager EasyBatteryManagerisapowermanagementprogramthatenablesusingthebatterypoweref? ...
-
Samsung M60 - page 146
Samsung Optimized Thismodeisappropriatefornormalconditions.Itmaximizesthesystemperformancewhenthecomputerisrunningon ACpowerwhilemaximizingthebatteryusagetimewhenthecomputerisrunningonbatterypower . Multimedia Thismodeisappropriatefora? ...
-
Samsung M60 - page 147
146 Using the Battery Calibration Function Whencharging/dischargingthebatteryrepeatedlyfora shorttimeonly ,thebatteryusagetimemaybereducedby thedifferencebetweentheactualbatterychargeandthe remainingchargedisplay . Inthiscase,theactualbatterycha ...
-
Samsung M60 - page 148
147 Using the Security Lock Port Y oucanconnectaKensingtonlocktotheSecurityLockporttopreventyourcomputerbeingstolenwhenyouhaveto usethecomputerinapublicplace. T ousethisfeature,youhavetopurchasetheKensingtonlockadditionally .T ous ...
-
Samsung M60 - page 149
Chapter 7. W indows Media Center About Package Contents and the Program Guide 149 Connecting and Setting Up Media Center 150 OptionalDevices 15 0 Using Media Center 154 StartScreenLayout 15 4 Pictures+Videos 15 5 Music 15 9 TV+Movies 16 3 Windows Media Center is provided for some versions of Windows V ista only . ...
-
Samsung M60 - page 150
149 About the Package Contents ThepackagecontentsofyourSamsungcomputermaydifferdependingonthecomputermodel. TheMediaCenterremotecontrol,external-typeremotecontrolsensorandTVtunercardarenotsuppliedwithyour computerandthedevicesarenotrequire ...
-
Samsung M60 - page 151
150 Connecting and Setting Up Media Center ThebasicusageofMediaCenterforMicrosoftWindowsVistaHomePremiumisdescribedbelow . Before Y ou Start! ■ ThismanualwilldescribeproceduresassumingthatyouareusingMediaCenterwithamouse. ■ SinceMediaCentersupp ...
-
Samsung M60 - page 152
151 TV T uner Card UsingaTVtunercard,youcanwatchandrecord TV programs. Somemodelshavebuilt-inTVtunercards. Thismanual describestheirusageassumingyourcomputerhasa built-inTVtunercard. Caution TherearetwotypesofTVtunercards,built-in ...
-
Samsung M60 - page 153
152 Media Center Setup ConnectallnecessarydevicesandsetupMediaCenter . Y ouhavetocompletethesettingstouseMediaCenter . 1 T urnthecomputeron. 2 Click Start > Windows Media Center or Start > All Programs > Windows Media Center . 3 Ifthefollowingstartscreenappe ...
-
Samsung M60 - page 154
153 4 IfyouhaveselectedCustomSetup,continuewith thesetupaccordingtotheSetupWizardinstructions. IftherearenoinstalledTVtunercards,the TV relatedsetupstepswillappearduringtheMedia Centersetup. Inaddition,ifthecomputerisnotcon ...
-
Samsung M60 - page 155
154 Start Screen Layout Before Y ou Start! If you selected Run Setup Later intheMediaCenterstartscreenordidnotcompletetheSetupWizard,theSetupWizardscreen appearswhenlaunchingMediaCenter . Ifyoucompletethesetup,theMediaCenterstartscreenappears. Click S ...
-
Samsung M60 - page 156
155 Pictures + Videos: Y oucanviewpictures,imagesand videoles. Music: Y oucanlistentomusicles,audioCDsandthe radio. TV + Movies : Y ou can watch and record TV programs andplayDVDtitles. Online Media: Y ou can access all kinds of multimedia contentoverthe. T a ...
-
Samsung M60 - page 157
156 3 IftheLibrarySetupscreenappears,select Add Folder to W atch . 4 Specify the path for the folder according to the instructionsonthescreen. 5 Ifthefollowingscreenappears,click Finish .Y oucan viewthenewlyaddedfolderinthePictureLibraryor VideoLibr ...
-
Samsung M60 - page 158
157 4 Ifyouselectapicture,thepictureisdisplayedinfull screen. Y oucanviewanotherpicturebyusingthePlay Controlbuttonsorthedirectionbuttonsonthe keyboard. 5 T oviewpicturesinaSlideShow ,clickon Play SlideShow . Alternatively ,select? ...
-
Samsung M60 - page 159
158 Viewing Pictures and V ideos Saved on Removable Media Theprocedurestoviewpictures,imagesandvideos savedonremovablemediainMediaCenteraredescribed below . 1 LaunchMediaCenter . 2 Insertaremovablemediawithpicture,imageor videoles. Removablemedia ...
-
Samsung M60 - page 160
159 InMusicofMediaCenter ,youcanplaymusiclesor audioCDs.Inaddition,youcanripthetracksofanaudio CD onto the computer and play them later individually or byusingaplaylist. Playing an Audio CD 1 LaunchMediaCenter . 2 PresstheEjectbuttonofthe? ...
-
Samsung M60 - page 161
160 4 IftheRipCDwindowappears,click Y es . 5 RippingaCDbeginsbyshowingrotatingCDicon on the right side that indicates ripping a CD is in progress.Whenrippingiscomplete,therippingCD completemessageappears. Note The ripped tracks are displayed in the Music > M ...
-
Samsung M60 - page 162
161 Using Playlists Y oucaneasilycreate,manageandplayaplaylistwith rippedmusicalbumsandmusiclesdownloadedfromthe Internet. 1 LaunchMediaCenter ,andselect Music > Music Library . 2 Y oucansearchforamusiclebyselectingthe album,art ...
-
Samsung M60 - page 163
162 6 Select Save As Playlist ,enteraplaylistnameand select Save .Ifyouhavearemotecontrol,youcan enteranameusingthenumericbuttonsonthe remotecontrol. 7 T oplaythesavedplaylist,select Media Center > Music Library > Playlist ,selectaplaylis ...
-
Samsung M60 - page 164
163 Before Y ou Start! TheTVfunctionisonlyavailablewhena TVtunercardis installedonyourcomputer . ■ IfyouhaveselectedInstallLaterintherstscreen oftheMediaCenterorhavenotcompletedthe CongurationWizard,theCongurationWizard ...
-
Samsung M60 - page 165
164 W atching TV 1 LaunchMediaCenterandselect TV + Movies . 2 Select Live TV or Guide fromthemenu. ■ When Live TV is selected A TVprogramisplayedimmediately .Switchtothe channelyouwanttostartwatchingit. ■ When Guide is selected WhentheGuideListisdis ...
-
Samsung M60 - page 166
165 ► Recording or reserving a recording in the Guide 1 LaunchtheMediaCenterandselect TV + Movies . 2 Select Guide fromthemenu. 3 Movetoaprogramtoberecorded. Right-clickoveraprogramtoberecordedandselect Record . A reddotappearsover ...
-
Samsung M60 - page 167
166 Playing a DVD TheprocedurestowatchaDVDtitlearedescribedbelow . 1 LaunchMediaCenter . 2 PresstheEjectbuttonoftheDVDdriveto open the trayandinsertaDVDtitle. Note IfyouinsertaDVDtitlewithoutstartingMedia Center ,the AutoPlay ...
-
Samsung M60 - page 168
167 Online Media Y oucanaccessmoreonlinecontentthroughOnline Spotlight. OnlineSpotlightisaserviceprovidedbycontent providersviatheMediaCenter .Y oucanenjoyallkinds ofmultimediacontentsuchasmovies,news,sports,etc. overtheInternet. Note ■? ...
-
Samsung M60 - page 169
Chapter 8. Appendix Using McAfee SecurityCenter (Optional) 169 Using Samsung Magic Doctor (Optional) 170 Reinstalling Software 172 Q & A 174 DisplayRelated 17 4 ModemRelated 17 5 WiredNetwork(LAN)Related 17 7 WirelessNetwork(WLAN)Related 17 8 GameandProgramRelated 18 2 Bluetooth 18 2 HDDVD? ...
-
Samsung M60 - page 170
169 Using McAfee SecurityCenter (Optional) A computervirusisaprogramthatdamagescomputerlesandinformationsavedonacomputer . A computer isinfectedbyanalreadyinfectedleorbyanothercomputerovertheInternet.Let’slearnhowtouseMcAfee Sec ...
-
Samsung M60 - page 171
170 Using Samsung Magic Doctor (Optional) MagicDoctoristroubleshootingsoftwareprovidedbySamsungComputer . A usercandiagnosesystemproblemsvia one-clickorbyselectingdiagnosticitems. Before Y ou Start! Thescreensusedinthismanualmaydifferfromactualscreensacc ...
-
Samsung M60 - page 172
171 Viewing My Computer Information Y oucanviewdetailedinformationaboutyourcomputerinSamsungMagicDoctor . Clickontheiconintheshapeofamonitoratthebottomofthemainprogramscreentoviewdetailedinformationabout thecomputer . ...
-
Samsung M60 - page 173
172 Reinstalling Software Y oucanreinstallsoftwareusingtheSystemSoftwareMedia,whenadevicedriverorcomputerapplicationisnot workingproperly . Before Y ou Start! Whensoftwareisnotworkingproperly ,itisrecommendedremovingthesoftwareusingthe AddorRemo ...
-
Samsung M60 - page 174
173 Standard Installation Ifyouselectthisoption,programsnotcurrentlyinstalledonthecomputerarelisted. MinimumInstallation Ifyouselectthisoption,programsarelistedthatneedtobeinstalledonthecomputer(drivers, Windowsupdates,etc.). Y ou can co ...
-
Samsung M60 - page 175
174 Q & A Thissectionprovidesinformationonpossibleproblems,solutionsandotherreferencesforusingthesystem. Q The LCD screen is too dark or too bright. A T urntheLCDbacklightonoradjusttheLCD brightness. Press Fn + ( )toturntheLCDbacklightonor press Fn + ( ...
-
Samsung M60 - page 176
175 Q I have connected a monitor (or projector) to the computer , but the colors on the monitor are abnormally displayed. A Check if the monitor and computer are properly connectedwiththesignalcableandreconnectthe cableifnecessary . Q I am trying to view the screen through a TV (or a Projection TV), by connecting it th ...
-
Samsung M60 - page 177
176 Q When you are unable to make a call when using a switchboard A Ingeneral,thedialtoneofaswitchboardoradigital phone switching system is not continuous unlike that ofaPSTNline.Therefore,themodemmaynotmake aphonecallasitmisreadsthedialtoneasabusy? ...
-
Samsung M60 - page 178
177 Q How can I receive a F AX in Sleep mode (Standby Mode)? A T oreceiveaF AXwhenthecomputerisinSleep Mode(StandbyMode),thecomputermustbe conguredasfollows. TheF AXprogrammustbeconguredsothatit receivesF AXESautomaticallyreferringtotheF AX? ...
-
Samsung M60 - page 179
178 Q I cannot nd an AP . A V erifywhethertheWirelessLANLEDison. Ifitisturnedoff,turnitonbypressingtheWireless LANOn/Offbutton( Fn + ). Q The Wireless LAN device is operating properly , but I cannot connect to the Internet or to another computer . ► This is due to an incorrec ...
-
Samsung M60 - page 180
179 A3 Checkthatthedevicedriverisinstalledproperly . Ifthedriverisnotproperlyinstalled,youwillnd ayellowexclamationmarkonthenetworkicon byclicking Start > Control Panel > System and Maintenance > Device Manager > Network Adapter . Q The signal strengt ...
-
Samsung M60 - page 181
180 A2 V erify whether the same network key (encryption key)hasbeenenteredforboththe APandthe computer .Thenetworkkeyisanencryptionkeyfor encryptingthedatatransmittedbetweenthe APand thecomputer .Itisrecommendedsettingthenetwork keymanually . ...
-
Samsung M60 - page 182
181 Q When connecting to a computer-to-computer (Ad Hoc) network, I cannot connect to another computer on the same computer-to-computer network. A1 Makesurethatthesecuritysettingsandnetwork nameofthecomputer-to-computer(AdHoc)network arecorrect. A2 ChecktheTCP/IP propertiesofthecompu ...
-
Samsung M60 - page 183
182 Q The Korean or Chinese characters in a business card received via Bluetooth are broken A1 IfyousendabusinesscardincludingKorean orChinesecharactersbyselectinga Select a business card in the le (*.vcf, *.vcd) option,the charactersonthereceivedcardwillbebroken. Thisis? ...
-
Samsung M60 - page 184
183 Q When no headset is found or cannot be connected A1 If the headset is already connected to another device,youwillnotbeabletondtheheadsetand cannot connect to the headset even if the headset is found.Disconnecttheconnectiontotheotherdevice andthenstartthesearchagain. A2 ...
-
Samsung M60 - page 185
184 A2 If your head set is a stereo headset ,youhave to check if the headset is connected as a stereo headset. T oresolvetheproblem,completetheprocedures below . Double-clicktheBluetoothiconinthenotication areaoftheT askbar ,selectthe Audiotab and check the connec ...
-
Samsung M60 - page 186
185 Q Can I burn a HD DVD disk using a general CD-RW or DVD-RW drive? A A generalCD-R WorDVD-R Wdrivedoes notsupport burningtheHDDVDformat. Q Can I burn a HD DVD disk using the CyberLink DVD Solution? A AlthoughtheCyberLinkDVDSolutionsupports burningtheCDandDVDformats,itd ...
-
Samsung M60 - page 187
186 Q Can I burn a Blu-Ray disk using a general CD-RW or DVD-RW drive? A A generalCD-R WorDVD-R Wdrivedoes notsupport burningtheBlu-Rayformat. Q Can I burn a Blu-Ray disk using the CyberLink DVD Solution (CDS)? A AlthoughtheCyberLinkDVDSolutionsupports burningtheCDandDVDformats,? ...
-
Samsung M60 - page 188
187 About Intel Media Sharing Software (Only for some models) IntelMediaSharingSoftwareenablesuserstoaccess,downloadandplayallkindsofmedialessuchasmusic, video,imageandpicturelesinthehomenetworkenvironment. IntelMediaSharingSoftwarerunsonInte ...
-
Samsung M60 - page 189
188 Product Specications Thesystemspecicationsmaydifferdependingonthederivedmodels.Fordetailedsystemspecications,referto theproductcatalog. NT -M60 Product Specications CPU * Intel®Core™2DuoProcessor Cache Memory * 2MB/4MB Main Memory * 512MB/1G/2G ...
-
Samsung M60 - page 190
189 Wireless LAN Specications (802.1 1ABG Card) Intel(R) PRO/Wireless 3945ABG Network Connection Device The Name of the Registered Equipment :SpecialLowPowerWirelessDeviceforWirelessDataCommunication Systems. Item Detailed Specications Physical Specications Dimensions 30.0×50.95mm(WidthX ...
-
Samsung M60 - page 191
190 Radio Specications RF Band 2.4GHz,5GHz Supported Channels Channelsallowedpercountry . Device T ransceiver Standard Output Power 5mW Modulation Scheme 1 1amode:OFDM 1 1bmode:DSSS 1 1gmode:OFDM Data Rate (Mbps)* 1 1amode**:54,48,36,24,18,12,9,6 1 1bmode:1 1,5. ...
-
Samsung M60 - page 192
191 Wireless LAN Specications (802.1 1ABG/N Card) Intel(R) PRO/Wireless 4965 AGN Network Connection Device The Name of the Registered Equipment :SpecialLowPowerWirelessDeviceforWirelessDataCommunication Systems. Item Detailed Specications Physical Specications Dimensions 30.0×50.95mm(Width? ...
-
Samsung M60 - page 193
192 Radio Specications RF Band 2.4GHz,5GHz Supported Channels Channelsallowedpercountry . Device T ransceiver Modulation Scheme 1 1amode:OFDM 1 1bmode:DSSS 1 1gmode:OFDM 1 1nmode:MIMO Data Rate (Mbps)* 1 1amode**:54,48,36,24,18,12,9,6 1 1bmode:1 1,5.5,2,1 1 1gmo ...
-
Samsung M60 - page 194
193 Registered T rademarks SamsungisaregisteredtrademarkofSamsungCo.,Ltd. SENSisaregisteredtrademarkofSamsungElectronics Co.,Ltd. Intel,Pentium/Celeronareregisteredtrademarksofthe IntelCorporation. Microsoft,MS-DOS,andWindowsareregistered trademarksof ...
-
Samsung M60 - page 195
194 Glossary TheGlossaryliststheterminologiesusedinthisUserGuide. Forterminologiesotherthanthese,lookinWindowsHelp. Backup A way to save the current data to restore it later if necessary . A backupisawaytorestorecomputerdata whenthedataorcomputeris ...
-
Samsung M60 - page 196
195 Firewall A security system used to protect an internal network or intranetfromexternalnetworks throughanauthenticationprocedure. Hibernation Mode A power mode that saves all data in memory to the harddiskandturnstheCPUandharddiskoff.When cancelingHibernationMode,allapplicationpro ...
-
Samsung M60 - page 197
196 Quick Launch Thisreferstoatoolbarthatcanbeconguredsothat youcanlaunchaprogramsuchasInternetExploreror displaytheWindowsDesktopwithoneclick.Y oucan addanyicontothequicklaunchareaoftheT askbar andlaunchfrequentlyu ...
-
Samsung M60 - page 198
197 USB (UniversalSerialBus) This refers to a serial interface standard developed to replace the conventional interface standards such asSerialandPS/2.WhileUSB1.1supports12Mbps (12millionbitspersecond),USB2.0supportsadata ratethatis40times(480Mpbs)fasterthanth ...
-
Samsung M60 - page 199
198 Index A A VStationNow 130 B Battery 142 BatteryCalibration 146 BIOSSetup 133 Bluetooth 105 BootingPriority 139 C CDDrive/Recording 50 Charge 143 Click 45 Connecting AP/ AP 98 Connect/OutputMonitor 60 Control Panel 82 CyberLinkPowerDVD 1 1 ...
-
Samsung M60 - page 200
199 Contact SAMSUNG WORLD WIDE [U.S.A. / U.K. / AUSTRALIA / HONG KONG / MALA YSIA / SINGAPORE] Contact SAMSUNG WORLD WIDE IfyouhaveanycommentsorquestionsregardingaSamsungproducts,contacttheSAMSUNGcustomercare center . Customer Care Center TEL W eb Site U.S.A. 1800SAMSUNG(7267864) www .samsung ...
-
Samsung M60 - page 201
200 [IT AL Y] Contatta SAMSUNG SehaicommentiorichiestesuiprodottiSamsungcontattailnostroServizioClienti. Customer Care Center TEL W eb Site IT AL Y 199153153 www .samsung.com/it/ [RUSSIA / UKRAINE] Customer Care Center TEL W eb Site RUSSIA 8-800-200-0400 www .samsung.ru UKRAINE 8-800-502-0000 www .samsun ...
A group of documents referred to as user manuals is also divided into more specific types, such as: Installation manuals Samsung M60, service manual, brief instructions and user manuals Samsung M60. Depending on your needs, you should look for the document you need. In our website you can view the most popular manual of the product Samsung M60.
Similar manuals
A complete manual for the device Samsung M60, how should it look like?
A manual, also referred to as a user manual, or simply "instructions" is a technical document designed to assist in the use Samsung M60 by users. Manuals are usually written by a technical writer, but in a language understandable to all users of Samsung M60.
A complete Samsung manual, should contain several basic components. Some of them are less important, such as: cover / title page or copyright page. However, the remaining part should provide us with information that is important from the point of view of the user.
1. Preface and tips on how to use the manual Samsung M60 - At the beginning of each manual we should find clues about how to use the guidelines. It should include information about the location of the Contents of the Samsung M60, FAQ or common problems, i.e. places that are most often searched by users in each manual
2. Contents - index of all tips concerning the Samsung M60, that we can find in the current document
3. Tips how to use the basic functions of the device Samsung M60 - which should help us in our first steps of using Samsung M60
4. Troubleshooting - systematic sequence of activities that will help us diagnose and subsequently solve the most important problems with Samsung M60
5. FAQ - Frequently Asked Questions
6. Contact detailsInformation about where to look for contact to the manufacturer/service of Samsung M60 in a specific country, if it was not possible to solve the problem on our own.
Do you have a question concerning Samsung M60?
Use the form below
If you did not solve your problem by using a manual Samsung M60, ask a question using the form below. If a user had a similar problem with Samsung M60 it is likely that he will want to share the way to solve it.